KEGG   Aspergillus niger: ANI_1_2270024Help
Entry
ANI_1_2270024     CDS       T01030                                 

Gene name
An02g01420
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ANI_1_2270024 (An02g01420)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_2270024 (An02g01420)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1644 aa AA seqDB search
MGNVLSKWLAPQPAGESEKRAGLGPPETATPPSPEQTPIRIDPPQMLLASPTEKSSSLHI
LPSSSSTHPPGLTNTNPVSSSVSNPSTVLPRAATKRAQLTVTTSSTKRRKVAEPRRPGSL
PGLSFASQAGRRHGHSSSDKASPSRSSRHPSSPSRSHRSTQSSSASPPPRYIPAHLQDEV
LASKSQSTARSPTPDSAGSVLDYPAAACAGLTLHSDPATDMSGSDDKGDSNLPLAGSDAR
ETSASENEVNDVEMDLVPTEKDSQTRSDHPDSMETTTSGDDNVTNSASDSVYPTPSSMST
YTAPTETRAHSKAEAGVASADRPSYDDQVAQVTQFMMQPMKEKQKGYVVSNSWLKRVYSR
SATHADKADKTAMEGDIGPVDNSDIVLVTDPANTGFKDEEGEPFVPLRPGLELGEDFEII
PQGGWDLIMQWYGLAEQSPAIVRYVHNTAAVGDQENLQYEINPPIFTILKLTNPSAGTSI
KTMKEKTMAPVRTLASRHTNFQKWLKNAKELAQIDMSTKVRVWRILGGLGSATASAAATP
AASRSASPAPSASLIANAGSNLVLDLNTFLSLSEGSQREVLDEPKDQTNNPNYNGKMTLG
VAGLNSSEIIVLEEKLPGTSGEWVSEASKQTLNRLGVPSGSLKNGAPAKVKTKSPATSGR
SSPVSEPIRGRRKDGKPRGCTGLSNLGNTCYMNSALQCVRSVEELTYYFLNDVYKKDLNP
SNPLAHNGDVAKAYANMLRQMYDEAGQSSFAPRQLKHTIGRYGPAFSGYGQQDSQEFLLF
LLDGLQEDLNRIMKKPYIEKPDSTDEMVHNKEALAEFADKCWDIYKARNDSVITDLFAGM
YKSTLVCPACDKVSIIFDPFNNLTLQLPIENLWGKEIFYFPLNKKPVLVDVEIDKNASVK
ALKEQVAKKMGTDPERLVMAEIYKNKFYKMFDNTSSIAECQISGNDDIGIYEVESVPTNY
NPDKPQKSYFSFSRSDHEEIPSLDSPRSDRLLVPIFNRVEKKRGNNPKNAQRSLFGVPSY
VVINREEFGDYDTIFRKVLSQVASMSTRDFLNEENTTEVSHEDSDTVIMNEDDAESADSK
IKTASVDGEDGMVDVSMRDADDSSSDAPARSESAISPNLRCLFEMKIIKSSSEVVPTGWS
TVDDHKEYPKMSFRIKTPVKKQKQSVDSTNGTEQKDEESGDKSSDSASGESASKPKAQDR
PMIRPGEGIVVDWTEQAHDALFAGSSRDKNSLRGAPTWTDVERVPDPELSKRRTLRQNRK
KRGVTLYECLDEFNKEEVLSENDAWYCPRCKEHRRASKKFELWKTPDILVMHLKRFSASR
GFRDKLDVLVDFPVEGLDMTGRVEAPEEGKSQIYDLFAVDNHYGGLGGGHYTAYAKNFFT
GQWNEYNDSSVSRPIDPQSVVTSSAYLLFYRRRSDRPLGGKVLEEITEASTRPNSDVDSQ
TESRGQSPSGEGRRLGGSSRNGSSSALTGVGAAHQSGDGGLPTGTQTKSGDDDWPPGYTN
VPSFGEQSLDRATQSEGMNFEDEEIGGGMQPSPFRPQDDTPSWSFSRATDAHGPSQMTTV
PTDDEDLLDDDASNQAVGGGDVSDPDLRMASLMDSPRGAAYPGTPMEETSFPDISAFAAD
GDDDEEDELPVVELQVHDEDQTLP
NT seq 4935 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgtgttatcgaagtggctcgcaccccagccagcaggggaaagtgagaaaagg
gccgggttggggcctccagaaacagccacgccgcccagcccagagcagacgccgatccgc
atcgaccctccccaaatgttgttagcatcacccacagaaaaaagttcttccctccacatc
ctcccatcctcttcctccacccacccccccggtctgaccaacaccaatccagtgtcgagc
tcagtttccaacccatctaccgtgctacctcgagctgccacgaaacgtgcgcagctcacc
gtcacgacgtcttccacaaagcgccgtaaagtagcagagcctcgcagaccaggatcgctt
ccgggtttgtcgttcgcctcgcaggccggaagacgtcacggccattcctcctccgacaag
gcctcgccctcgcgctcctcccgtcacccttcctctccttcccgatcgcatcgcagcact
cagagctcctcggcttcaccgcctccccgctacattcccgcccatctgcaggacgaagtc
ctcgcctccaaatcccagtccaccgctcgttcccctaccccggactccgctggaagtgtc
ctcgactatcccgcggccgcctgcgctggtctgaccctccacagcgaccctgcgaccgat
atgtccggctctgacgacaagggagactcgaacctcccgcttgccgggtccgatgctcgc
gaaacctccgcctcggagaatgaggtgaacgatgtggagatggacttggttccgacagaa
aaggacagccagacccgttccgaccacccggattcgatggaaaccacgacatcgggcgat
gacaacgtaaccaactcggcgtcggacagtgtgtatcccactccttccagcatgtccacc
tataccgcccccacagagacccgggcccattctaaagcagaggccggggttgcgtcagct
gatcgaccatcttacgatgaccaggtcgcacaggtgacccagtttatgatgcagccgatg
aaggagaaacaaaagggatatgtggtgtcgaattcgtggctgaagcgagtgtactcgcgg
agtgctactcatgcagacaaggctgataagacggcgatggagggagatatcggaccagtc
gataactcggatattgttctggtcaccgacccggccaacactggtttcaaggacgaggaa
ggagaaccctttgttcctttgaggcctggcttggagcttggcgaagattttgagattatc
cctcaagggggctgggacctgatcatgcagtggtatggtctggcagaacagtccccggcc
atcgtccgttacgttcacaacaccgccgccgtaggcgaccaggagaacctccaatacgag
atcaaccctccgatcttcacgatcttgaagctcacgaacccctctgccggcacttctatc
aagacgatgaaggagaagacgatggccccagtgaggacactggccagtcgacacaccaac
ttccagaagtggctgaagaacgccaaagaactcgctcaaatcgacatgtcgacgaaggtt
cgtgtttggaggattctgggtggtctcggtagcgccaccgcatcggcagcagccacccca
gctgcatcccgcagtgcttctccagctccgtccgcctccctcatcgccaacgctggaagc
aacctcgttctcgacctgaacaccttcctttccctgtcggaggggtcgcagcgtgaggta
cttgacgagccgaaggaccagacgaacaatcccaactacaatggtaaaatgactctgggc
gttgcgggtctcaacagcagcgaaatcatcgtgctggaagagaagctccctggaacgagc
ggagaatgggtatcggaagcctccaagcagacacttaaccgtctgggggtgccgtccggt
agcctaaagaacggagctcccgcaaaggtgaagaccaagagtcctgctaccagcgggcga
tcgtctccggtctcagaacccatcaggggtcgacgcaaggacgggaaaccccgcggctgc
actggtttgagcaatcttggaaacacttgttacatgaactcggccctgcagtgcgttcgc
agtgtcgaggaattaacctactatttcttgaatgacgtttacaagaaggacctcaacccc
agcaatcctctagctcataatggtgatgtggctaaagcatacgcgaatatgttgcgtcag
atgtatgatgaggcaggacaatcttcgtttgcgccccgtcagctgaagcacaccatcggc
cgctatggaccggccttctccggttacggacagcaggattcccaggaattccttctcttc
cttctggatggtcttcaggaggatctgaaccgtattatgaagaagccctacattgaaaag
ccggactcgacggacgagatggtgcataacaaggaagctctcgcagagtttgcggacaag
tgctgggatatctacaaagcccgtaacgactccgtcattaccgacctctttgctggtatg
tacaagtcgacgctggtctgccctgcttgcgacaaggtcagcatcattttcgaccctttc
aacaacctgacccttcagcttccgatcgagaatctctggggtaaagagattttctacttc
cctctcaacaagaagccggtccttgtcgatgtcgaaatcgacaagaacgccagtgtcaag
gcgctgaaggagcaggtcgcaaagaaaatgggaaccgaccctgagcgcctcgtgatggct
gagatctacaagaacaagttctacaagatgttcgacaacacgagctcgattgcggagtgc
cagatcagcggcaacgacgacattggtatctacgaagtcgagtcagtacctacgaactac
aaccccgacaagccccagaagagctacttctccttcagtcgctcggatcatgaggagatc
cccagtttggactcgcctcgatctgaccgcttgctcgtccccatctttaaccgagtcgag
aagaaacggggaaacaaccccaagaatgcgcaacggtcgctcttcggagttccatcgtat
gtggtcatcaatcgggaggagtttggggactacgatacgatcttccgcaaggtcctgtcg
caggtcgcctcgatgtccacccgtgacttcctgaatgaggagaatacgaccgaggtcagc
catgaagactcagacaccgttattatgaacgaggatgatgcggagtcggctgactcgaag
atcaagactgcgtccgttgacggcgaggacggcatggtcgatgtctcgatgcgtgacgcg
gatgacagttcaagcgacgccccagcccgctccgaaagtgctatttcccctaatttgcgc
tgtcttttcgagatgaagatcatcaagtcgagtagcgaggttgttcccactgggtggtca
accgtggatgaccacaaggagtatccgaagatgtcatttagaatcaagacgccggtgaag
aagcagaaacagtccgtggacagcacgaatggcacggagcagaaggatgaagagtccgga
gataagagctccgacagtgccagtggtgaatcggcttctaagcctaaggctcaggaccgg
ccgatgatccgccccggtgagggtattgtagtggactggactgagcaagctcatgacgct
ctcttcgctggaagcagtagagacaagaactccctgcgtggggcgccgacatggacggac
gtcgaacgcgtgcctgacccggaactgagcaagcgccgtactctgcgccaaaaccggaag
aagcggggcgtgacgctctacgagtgtctggacgagttcaacaaagaggaggtcctttcc
gagaacgatgcttggtactgtccccgctgcaaggagcaccgtcgggccagcaagaagttc
gagttgtggaagacaccggacattctggtcatgcacctcaagaggttcagcgccagccgc
ggattccgcgacaagctggatgtcctggtcgacttcccagtggagggcctcgatatgacc
ggcagggtcgaggcgcctgaagagggcaagagtcagatctacgacctcttcgccgtcgac
aatcactacggaggccttggtggcggacactacacagcgtacgccaagaactttttcacc
gggcagtggaacgaatataacgattcttccgtctcgcgcccgattgatccgcagagtgtg
gtcacctcgtcggcgtatctgctgttttaccggcgccggtccgaccggccgctgggcggc
aaggtgttggaggagatcacggaagcgtcgacacggccgaacagcgacgtggactcgcag
accgagtctcgcggacagtctccgtcgggggaaggccggcgcctcggcggctcctcccgc
aatgggtcgtcgagcgccttaaccggagtcggagcagctcaccaatcgggagatggtggt
ttgccaactggaacccaaacgaagagcggggatgatgactggccgccgggatataccaac
gtcccatcatttggcgagcagagcctagatcgcgcgacgcaatcggaaggtatgaatttc
gaagatgaggagattggcgggggcatgcagcccagcccgttccgccctcaggacgacaca
ccctcgtggtcgttcagtcgcgccacagatgctcacggcccttcacagatgaccacagtt
ccaactgacgacgaagatctactcgacgatgacgcgagcaaccaggccgtaggcggcggc
gatgtcagcgacccggaccttcggatggcctctttgatggacagtccacgcggggccgcc
tacccaggtaccccgatggaggagacgtcattcccggacatttcggcatttgcagcggac
ggtgacgatgacgaggaggatgagttgccggtggtagaactccaagtgcatgatgaagac
cagacactgccgtag

DBGET integrated database retrieval system