KEGG   Aspergillus niger: ANI_1_2276104Help
Entry
ANI_1_2276104     CDS       T01030                                 

Gene name
An12g09940
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ang  Aspergillus niger
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ang01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ang01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MPGETNIPPRRDRHVSKVHIADTPITLRNWHKHVNWLNVTMIVLIPLYGCIQALWTPLRL
KTAIWAVAYYFFTALGVTAGYHRLWAHRSYTATLPLRITLALAAGGSVQGSARWWARLHR
SHHRYTDTERDPYSVHKGIFYAHFGWMILKQNPKRFGRTDISDLNADPVVVWQHRHFLKI
VVLMGLVVPMLVAGIWGDWWGGFVYAGILRIFFVQQATFCVNSLAHWLGEQPFDDRNSPR
DHVVTALATMGEGYHNFHHEFPSDYRNAIRWYQYDPTKWAIWCWGQMGLARDLKMFRENE
IEKGRVQQLQKKVDKKRAELDWGTPLSELPVMEWEEFVERARSRALVVVAGVVHDVEDFV
KEHPGGRAMIQAGVGKDATAMFNGGVYYHSNAAHNLLSMMRVAVIRGGSEVEIWKRPQKE
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgaaaccaatataccccctcgtcgagacagacatgtctccaaagtccacatc
gccgacacccccatcaccctccggaactggcacaaacatgtcaactggctgaacgtgacc
atgatcgtcctgatccccctctacggctgcatccaagctctctggacacctctacgacta
aaaaccgccatctgggcagtagcatactacttcttcacagccctaggcgtcacagcaggc
taccaccgcctctgggcccacagatcctacacagcaaccctccccctccgcatcaccctg
gccctcgccgccgggggctccgtccaaggttccgcacgctggtgggcacgcctgcaccgc
tcgcaccaccggtacacagacacggagcgggacccttactccgtacacaagggcatcttc
tacgcgcacttcggctggatgatactgaagcagaacccgaagcggttcggccgaaccgac
atctccgatctcaacgccgaccccgtggtcgtctggcagcatcgacacttcctgaagatc
gtggtcctcatggggcttgtcgttccgatgctcgtcgcaggcatctggggtgattggtgg
ggcgggttcgtgtacgcgggcatcctgcgcatcttcttcgtgcagcaggccactttctgc
gtgaactctctggctcactggctcggcgagcagccgttcgatgatcgcaattcaccccgt
gatcatgtcgtcacggcgttggcgacgatgggtgaggggtatcataattttcatcacgag
tttccgtcagattatcgcaatgctattcggtggtatcagtatgatccgaccaagtgggcc
atttggtgctggggacagatggggttggcgcgtgatttgaagatgtttcgcgagaatgag
attgagaaggggagggtgcagcagttacagaagaaggtggataagaaacgggcagagttg
gattgggggactccgttgagtgagttgccggttatggagtgggaggagtttgtcgagagg
gcgaggagcagggcgttagtcgttgttgctggggtggtgcatgatgttgaggacttcgta
aaggaacatcctggtgggagggctatgatccaggctggtgttgggaaggatgcgaccgct
atgtttaatggtggggtgtattatcattcgaatgcggcgcataatctgctgtcgatgatg
cgggtggcagttattcggggtgggagtgaggtggagatttggaagaggccgcagaaggag
atgtag

DBGET integrated database retrieval system