KEGG   Aspergillus niger: ANI_1_228154Help
Entry
ANI_1_228154      CDS       T01030                                 

Gene name
An17g01660
Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 575 aa AA seqDB search
MATATMTMPPPPKAKKNAKLPPENERFMRACSDIANALIQEYEAQRDPKKPKRDINLNKL
RGQVAKKHALATQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMSKPHRCPH
IAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSLGHS
VDKVEYIIMGGTFMSLPEDYRESFVAQLHNALSGYQTDNVDEAVQAGEMSNVKCVGITIE
TRPDYCLDQHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAGFKV
VSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYKNYT
PNALIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDV
RTREVGINEVKNKIRPSQVELIRRDYTANGGWETFLAYEDPKQDILIGLLRLRKCSPTHT
FRPEFTGQQTSIVRELHVYGSAVPLHGRDPRKFQHRGFGTLLMEEAERIAREEHGSTKIS
VISGVGVRSYYARLGYTLDGPYMSKMLDPIEDEEF
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgctaccatgactatgccgccaccccccaaggctaagaaaaatgccaaactt
cccccggagaatgaacgtttcatgagagcttgctccgatattgcgaatgccctgatccaa
gaatatgaagcgcaacgcgatcccaagaaacccaagagagatatcaacctcaacaaactg
cggggtcaagtagccaaaaagcatgccctggctacacaacccccattgacggccattatc
gcggccgtccctgagcactacaagaaatacatccttcccaagttgattgcgaagcccatc
agaacctcgtccggtatcgcggttgtcgcggtcatgagcaaaccccatcgttgtccccat
attgcctacaccggaaacatctgcgtctactgccctggtggccctgattccgactttgag
tactctacacagtcctataccggatacgagccgacctcgatgcgtgcgatccgcgcccgg
tacgatccgtttgagcaggcccgaggacgtgtggaccagatcaagtctctgggtcacagc
gtggacaaggtggagtacatcatcatgggtggaacgttcatgtctctgccggaggactac
cgtgagtcgttcgtggctcagctgcacaacgcgctcagtggatatcaaacggacaatgtc
gacgaagcggtacaggctggtgagatgagtaacgtgaagtgcgtgggtatcacaatcgaa
acaagaccggactattgtctcgaccaacatttgagcagtatgctccgctacggatgtact
agattggagatcggtgtccagagtttgtatgaggatgtcgccagagacacgaacagaggt
cacactgtcgcggctgtcgcagaaacattcaagcttgcaaaggatgccggcttcaaggtc
gtcagtcatatgatgccggatctgcccaacgtgggcatggagcgtgacctgttccagttc
caggagtacttcgagaacccggctttccgaacggatggtctgaagatctaccccacgctg
gtcatccgtggaactggtctgtacgagctatggaggacgggtcgctacaagaactacacg
ccaaacgccctgatcgacctggtcgcccgcatcctcgctctggtgcccccgtggacgcgt
atctaccgagtccagcgtgatatccccatgcccctggtgacctcgggagttgagaacggc
aacttgcgcgaactggccttggcacgcatgaaggacttcggaactacttgccgcgacgta
cggacccgtgaagtcggtatcaacgaagttaagaacaagattcgcccatcccaagtcgaa
ctgatccgccgtgactacacagcaaacggaggctgggagacattcctcgcctacgaggac
cccaagcaagatatcctgatcggtctgctgcgtctgcgcaagtgcagcccaacccacacc
ttccggcccgagtttaccggtcagcagaccagtatcgtgcgcgagctgcacgtgtacgga
tccgccgttcctctccacggacgtgacccgcgcaagttccaacaccgcggattcggaact
ctgctcatggaagaggcagagcggattgcccgcgaggagcacggcagcacgaagatcagt
gttatctctggtgtcggtgtgcgcagctactacgctcgtctgggatacactctcgacgga
ccgtacatgtccaagatgctcgacccgattgaagacgaggagttttaa

DBGET integrated database retrieval system