KEGG   Aspergillus niger: ANI_1_2320184Help
Entry
ANI_1_2320184     CDS       T01030                                 

Gene name
An04g10300
Definition
longevity-assurance protein (LAC1)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ang  Aspergillus niger
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ang00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 437 aa AA seqDB search
MPASSTDMSRRGSREFKARGLPKSSKLTENIFIKRVAHWPATDGATPGIDISFQLVVFLL
LTHLGVPALRPYTSKFFRLSYCNQSTEKYGIGYDDLYFIAFWIILLTGLRASCMKYILAP
LSRRWGVSKAKDATRFAEQGWISLYYSMMWTLGMYLYYKSPYFLNMEELWTEWPQREMDG
LVKAYYLGQLSFWIQQVLVINIEDRRKDHWQMLTHHFVTISLMATSYVYHQTKVGHLILV
LMDVIDLFLPLAKCLKYLGFTTICDILFGLFIVSWLFARHLLFLITCWSIYTDFPRIVPP
GCYRGTAKDLQGPFPVPENWGYLIEPFYDPAGTVCMNNTIMYSFLSFLLLLQVLMVIWFA
IIARIAIRVLEGRRADDPRSDGEQDELVEKEQRNNEAPQGSAKNISGNAVSQDRWQQHTG
GRQRRALRQPPGSGGAA
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgccagccagctctactgacatgagtcgcagaggatcgcgtgaattcaaagccagggga
cttccgaaaagttccaagttgacagagaatattttcatcaagcgcgtggcccattggcct
gccactgacggcgcaacaccgggaatagacatttcattccagctggttgttttcctcctt
ctcacacatcttggtgtacccgctctacgaccatatacgtcgaagttcttcaggctatct
tactgtaaccagagcaccgaaaagtatggaattggatatgatgacctctactttatagcc
ttctggattatactcctcacgggtctaagggccagctgtatgaagtatattcttgctccg
cttagccgacggtggggagtatcaaaagccaaagatgccactcggtttgcggagcaagga
tggatatccttgtattacagcatgatgtggacactaggcatgtacctctattataagtca
ccgtatttcctcaacatggaggagctgtggaccgaatggcctcagagggaaatggacggc
ctggttaaagcatattacctgggacagttgtctttctggattcagcaagtgctagtgatc
aacatcgaggaccggcggaaagaccattggcaaatgctaacccatcatttcgtaacaatc
agccttatggcaacctcgtacgtctatcaccaaaccaaggtcggacacttgattctagtg
ctcatggacgtaattgatctctttctgccactagcaaaatgtcttaaatatctaggcttc
accacaatctgtgatatcctgtttgggcttttcattgtatcgtggctctttgcgcgccat
ctgctattcttgattacttgttggagtatctatactgatttcccccgaatagtcccaccc
gggtgctatcggggaactgcaaaagatcttcagggaccgtttccagttccagagaactgg
gggtatttgatcgagcctttttatgatccagcaggaacagtgtgtatgaacaataccatc
atgtatagctttctatcatttcttctcctgcttcaggtcttgatggtcatatggttcgca
atcattgcgcggatcgccatacgggtgttggagggcaggagagcagatgatcctcgaagc
gacggtgaacaggacgaactagtggagaaggaacaaaggaataacgaagcaccccagggg
tcggccaagaatatcagcggaaatgcggtaagccaggacaggtggcaacaacacaccggt
ggacgccagcggcgtgctcttcgccagcccccaggttcgggaggagccgcataa

DBGET integrated database retrieval system