KEGG   Aspergillus niger: ANI_1_240164Help
Entry
ANI_1_240164      CDS       T01030                                 

Gene name
An18g02020
Definition
protein disulfide-isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ang  Aspergillus niger
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ang04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MVRLSNLVSCLGLASAVTAAVVDLVPKNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYE
ELGQAFAHASDKVTVGKVDADEHRDLGRKFGVQGFPTLKWFDGKSDEPEDYKGGRDLESL
SSFISEKTGVKPRGPKKEPSKVEMLNDATFKGAVGGDNDVLVAFTAPWCGHCKNLAPTWE
ALANDFVLEPNVVIAKVDADAENGKATAREQGVSGYPTIKFFPKGSTESVPYEGARSEQA
FIDFLNEKTGTHRTVGGGLDTKAGTIASLDELIASTSAADLAAAVKKAATELKDKYAQYY
VKVADKLSQNAEYAAKELARLEKILAKGGSAPEKVDDLISRSNILRKFVGEEKEAKDEL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtccgtctcagcaatctcgtgagctgcctcggcctggcctccgcggtcaccgcagca
gtggtcgatctcgtccccaagaacttcgacgacgtcgtcctcaagtccggcaagcccgct
ctggttgaattcttcgctccctggtgcggccactgcaagaacctcgcgcccgtgtatgaa
gagctgggccaggcattcgcccatgcctccgacaaggtcaccgtcggcaaggttgatgcg
gacgagcaccgcgacttgggccgcaagttcggtgtccagggattccccacgctaaagtgg
ttcgacggaaagagtgacgagccggaggattacaagggtggtcgtgatttggagagtctg
tcttcgttcatctctgagaagacgggcgtcaagccccgtggtcctaagaaggagcccagc
aaggtggagatgctgaacgacgcgactttcaagggcgctgttggtggcgataatgatgtt
ctggttgcgttcaccgcgccgtggtgtggacactgcaagaacctcgctcctacctgggaa
gccctggccaacgacttcgtcctcgagcccaacgttgtgatcgccaaggtcgacgccgac
gctgagaacggcaaggccaccgccagagagcagggcgtgtccggataccccaccatcaag
ttcttccccaagggctctacggaatctgttccctatgagggtgcccgctctgagcaggcc
ttcattgacttcctcaacgagaagaccggcacccaccgtaccgttggcggcggactcgac
accaaggccggcaccattgctagcctggacgagctgattgccagcacttctgctgctgac
ctggccgccgcagtcaagaaggctgctacggagcttaaggacaagtacgctcagtactac
gtcaaggttgcggacaagctgagccagaacgccgagtatgccgctaaggagcttgctcgt
ctggagaagatcctggccaagggtggatcggcccctgagaaggtggatgaccttatctcc
cgcagcaacatccttcgcaagtttgttggtgaggagaaggaggccaaggatgagctgtag

DBGET integrated database retrieval system