KEGG   Aspergillus niger: ANI_1_242084Help
Entry
ANI_1_242084      CDS       T01030                                 

Gene name
An09g02240
Definition
N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ang  Aspergillus niger
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ang00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ang00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:ang00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ang00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MLLARLWPACLTLLVAGAAAVKVNPLPAPRNISWTSSGPKQLASFVSLRASQDTPDFILA
NGWNRAWDSIVSLQWVPAATEGPMSSYQPFPTATAAAGVTKRSSQALPSLQFVDVNVADL
DADLQHGVDESYTLEVTESATSVVIEAPTVWGALHAFTTLQQLVISDGQGGLIIEQSVKI
QDAPLYPYRGIMLDTGRNFISVSKIYEQLDGMSLSKLNVLHWHMEDTQSWPVQIDAYPEM
IHDAYSPREVYSHADMRNIVAYARARGVRVIPEIDMPSHSASGWKQVDPQMVTCVDSWWS
NDDYALHTAVEPPPGQMDIIYNGTYDVVREVYNELSGIFPDNWFHVGADEIQPNCFNFSS
YVTQWFAEDPSRTYNDLAQYWVDHAVPIFQNYSSSRQLVMWEDIVLSTEHAHDVPTNIVM
QTWNNGLDYINQLTAKGYDVIVSSSDFMYLDCGMGGFLTNDPRYDVMSNPDPNTPNFNYG
GNGGSWCAPYKTWQRIYDYDFTQNLTDAQAQHIVGAEAPLWSEQVDDVTVSSLFWPRAAA
LAELVWSGNRDENGHKRTTLMTQRILNFREYLVANGVQAKALVPKYCVQRPHTCDLYRNQ
SVIQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgctcgcctctggccggcgtgcctcacgctgctcgtggccggggccgccgcc
gttaaggtcaatcctttaccagctccgcgcaacatttcttggacttcttcgggtcctaag
cagctggcaagctttgtcagtctccgtgcatcgcaagatacccctgacttcattctcgcc
aatggatggaatcgcgcatgggattctattgtctccttacaatgggtacccgcagcgacc
gaaggccccatgtcatcctatcagccttttcccaccgcgacggccgcggccggggtcact
aaacggtcctcgcaggcactgccatcgctgcagtttgttgatgtgaatgtggctgatctt
gacgcggatctgcagcatggagttgacgagtcttacacactggaggtcaccgagagcgct
acttcagtcgtcatcgaggcacccactgtctggggagcactccatgcctttactactctc
cagcagctggtcatctctgacggacagggcggcttgataatcgagcagtcagttaagatc
caggatgcgccgctctatccttaccggggtatcatgcttgatactggtcgaaattttatc
tcagttagcaagatctatgagcagctggacggcatgtcgctttctaagctcaatgttcta
cactggcacatggaagacacccaatcgtggccagtgcagattgatgcctatccagagatg
atccatgatgcctactccccgcgcgaggtatattcacacgccgatatgcgcaacatcgta
gcgtatgcccgagcacgcggcgtacgggtcattcctgagattgatatgcccagccattcc
gcttctggatggaaacaggttgacccccagatggtcacctgcgtggattcctggtggtct
aatgatgattatgccttgcataccgcggtagaacccccacctggtcaaatggacatcatt
tacaacggcacatatgatgtggtccgagaggtatataatgagctgtccggtatcttcccg
gacaactggttccatgttggagcggatgagattcagcctaactgctttaacttcagcagc
tacgtcacccagtggttcgcagaggatccgtcgcgcacttacaatgatctggcccagtac
tgggtagaccatgctgtaccgatcttccagaactacagttcctcgcggcagctggttatg
tgggaagatatcgtgctatctacggaacatgcgcatgatgtacccacaaatatcgtgatg
caaacctggaacaacgggctggattacatcaatcagctgactgccaaaggctacgatgtg
attgtgtcatcatcggacttcatgtatctggactgtgggatgggtggcttcctaaccaat
gatccccgatacgatgtaatgagcaatccagatccaaacactcccaacttcaactatggc
ggcaacggaggctcgtggtgtgcgccgtacaagacgtggcagcgtatctacgactatgac
ttcacgcaaaatctgactgacgcccaggcccagcacatcgtgggcgcggaggcacccctc
tggtcggaacaagtagatgatgtgactgtctccagtctgttctggccgcgcgccgctgct
ctggcagagctggtatggtctgggaatcgggatgagaatggacataagcgcacgacgctg
atgacgcagcgtattttgaactttcgcgagtacttggtggccaatggggtgcaggcgaaa
gcgctggttcctaaatactgtgtgcagcgcccacatacctgcgacttgtatcgcaaccag
agtgtaattcagtaa

DBGET integrated database retrieval system