KEGG   Aspergillus niger: ANI_1_242084Help
Entry
ANI_1_242084      CDS       T01030                                 

Gene name
An09g02240
Definition
N-acetylglucosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ang  Aspergillus niger
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_242084 (An09g02240)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ANI_1_242084 (An09g02240)
   00603 Glycosphingolipid biosynthesis - globo series
    ANI_1_242084 (An09g02240)
   00604 Glycosphingolipid biosynthesis - ganglio series
    ANI_1_242084 (An09g02240)
   00511 Other glycan degradation
    ANI_1_242084 (An09g02240)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ANI_1_242084 (An09g02240)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 604 aa AA seqDB search
MLLARLWPACLTLLVAGAAAVKVNPLPAPRNISWTSSGPKQLASFVSLRASQDTPDFILA
NGWNRAWDSIVSLQWVPAATEGPMSSYQPFPTATAAAGVTKRSSQALPSLQFVDVNVADL
DADLQHGVDESYTLEVTESATSVVIEAPTVWGALHAFTTLQQLVISDGQGGLIIEQSVKI
QDAPLYPYRGIMLDTGRNFISVSKIYEQLDGMSLSKLNVLHWHMEDTQSWPVQIDAYPEM
IHDAYSPREVYSHADMRNIVAYARARGVRVIPEIDMPSHSASGWKQVDPQMVTCVDSWWS
NDDYALHTAVEPPPGQMDIIYNGTYDVVREVYNELSGIFPDNWFHVGADEIQPNCFNFSS
YVTQWFAEDPSRTYNDLAQYWVDHAVPIFQNYSSSRQLVMWEDIVLSTEHAHDVPTNIVM
QTWNNGLDYINQLTAKGYDVIVSSSDFMYLDCGMGGFLTNDPRYDVMSNPDPNTPNFNYG
GNGGSWCAPYKTWQRIYDYDFTQNLTDAQAQHIVGAEAPLWSEQVDDVTVSSLFWPRAAA
LAELVWSGNRDENGHKRTTLMTQRILNFREYLVANGVQAKALVPKYCVQRPHTCDLYRNQ
SVIQ
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctccttgctcgcctctggccggcgtgcctcacgctgctcgtggccggggccgccgcc
gttaaggtcaatcctttaccagctccgcgcaacatttcttggacttcttcgggtcctaag
cagctggcaagctttgtcagtctccgtgcatcgcaagatacccctgacttcattctcgcc
aatggatggaatcgcgcatgggattctattgtctccttacaatgggtacccgcagcgacc
gaaggccccatgtcatcctatcagccttttcccaccgcgacggccgcggccggggtcact
aaacggtcctcgcaggcactgccatcgctgcagtttgttgatgtgaatgtggctgatctt
gacgcggatctgcagcatggagttgacgagtcttacacactggaggtcaccgagagcgct
acttcagtcgtcatcgaggcacccactgtctggggagcactccatgcctttactactctc
cagcagctggtcatctctgacggacagggcggcttgataatcgagcagtcagttaagatc
caggatgcgccgctctatccttaccggggtatcatgcttgatactggtcgaaattttatc
tcagttagcaagatctatgagcagctggacggcatgtcgctttctaagctcaatgttcta
cactggcacatggaagacacccaatcgtggccagtgcagattgatgcctatccagagatg
atccatgatgcctactccccgcgcgaggtatattcacacgccgatatgcgcaacatcgta
gcgtatgcccgagcacgcggcgtacgggtcattcctgagattgatatgcccagccattcc
gcttctggatggaaacaggttgacccccagatggtcacctgcgtggattcctggtggtct
aatgatgattatgccttgcataccgcggtagaacccccacctggtcaaatggacatcatt
tacaacggcacatatgatgtggtccgagaggtatataatgagctgtccggtatcttcccg
gacaactggttccatgttggagcggatgagattcagcctaactgctttaacttcagcagc
tacgtcacccagtggttcgcagaggatccgtcgcgcacttacaatgatctggcccagtac
tgggtagaccatgctgtaccgatcttccagaactacagttcctcgcggcagctggttatg
tgggaagatatcgtgctatctacggaacatgcgcatgatgtacccacaaatatcgtgatg
caaacctggaacaacgggctggattacatcaatcagctgactgccaaaggctacgatgtg
attgtgtcatcatcggacttcatgtatctggactgtgggatgggtggcttcctaaccaat
gatccccgatacgatgtaatgagcaatccagatccaaacactcccaacttcaactatggc
ggcaacggaggctcgtggtgtgcgccgtacaagacgtggcagcgtatctacgactatgac
ttcacgcaaaatctgactgacgcccaggcccagcacatcgtgggcgcggaggcacccctc
tggtcggaacaagtagatgatgtgactgtctccagtctgttctggccgcgcgccgctgct
ctggcagagctggtatggtctgggaatcgggatgagaatggacataagcgcacgacgctg
atgacgcagcgtattttgaactttcgcgagtacttggtggccaatggggtgcaggcgaaa
gcgctggttcctaaatactgtgtgcagcgcccacatacctgcgacttgtatcgcaaccag
agtgtaattcagtaa

DBGET integrated database retrieval system