KEGG   Aspergillus niger: ANI_1_2466074Help
Entry
ANI_1_2466074     CDS       T01030                                 

Gene name
An08g10680
Definition
uroporphyrinogen-III synthase (UroS)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ang  Aspergillus niger
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ang00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MTSPENTNKPPIILLKTKSTPHDNYSDYFHQPTSDYNPTFIPVLSHNFHTERLRSIRALF
TSGALLPPQSQDKDKHHARKYGGLIFTSQRAVEGFGRVLAELDDDPSAKQTIASSSTNLP
IYTVGPATHRSLTTIVNSYLPHASIHGADTGNGEALAKFILQHYNSLYTTTPSDTNGDVS
KPPLLFLVGEQRRDIIPRTLMSSELVPEQRIGVDEVVVYETGVMEGFEGQFRGVVERERE
VMKGDSDRVVWVVVFSPTGCEGMLRGLGYFDNKGGKGDWGDKGERRFFVATIGPTTRDHL
RKEFGFEADVCAERPSPEGVGEGIERFMREKKNLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccagagaataccaataaacctcccatcatcctgctcaaaaccaaatccacc
ccccacgacaactactccgactacttccaccaacccaccagcgactacaatcccaccttc
atcccggtcctctcgcacaacttccacaccgagagactacgctccatccgcgcgctcttc
acctccggagccctcctccctccccaatctcaagataaagataaacaccatgctcgaaaa
tacggcggcctgatcttcaccagccagcgcgcagtcgaaggcttcggcagagtacttgcc
gaacttgatgatgacccctcagcaaagcaaacaatagcttcctcctccacaaacctccca
atctacaccgtcgggcccgcaacccaccgctccctgaccaccatcgtgaacagctaccta
ccgcacgcgagcatccacggcgcggatacagggaatggagaggcattagcgaagttcatt
ctccaacattataattctctctacactactaccccgtcagacactaatggggatgtgtcg
aagccaccgttgcttttccttgttggtgagcaacgacgggatattatcccgcggacactt
atgagctcggagcttgtcccggaacaacgcattggtgtggatgaggtggttgtgtatgag
acgggggtgatggaggggtttgaggggcagtttaggggggttgttgagcgggagagggag
gttatgaagggtgatagtgatagggtggtgtgggtggtggtgttttcgccgacggggtgt
gaggggatgttgagggggttgggatattttgataataagggtggtaagggtgattggggg
gataagggtgaaaggaggttctttgttgcgacgattgggccgacgacgagggatcatttg
aggaaggagtttgggtttgaggcggatgtttgtgcggagaggccgagtcccgagggggtg
ggggaggggattgagagattcatgagggagaagaagaatttgtcatga

DBGET integrated database retrieval system