KEGG   Aspergillus niger: ANI_1_248054Help
Entry
ANI_1_248054      CDS       T01030                                 

Gene name
An06g01920
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 490 aa AA seqDB search
MASVLSISLLSEAEYGCEHLATQLGQDVSTAEQFKNAFLKAHNSLGHFPRSMESSTKQNG
RLKAKDFLKPKYTCLTCGEAMPMGGRKAHTEKTSHQFYMESRARTVYCQACGDFVYDHGL
ERLRCSTTESALQVAKKRRFSDSSADELYIRSNASKRPCAKQGVRGLFNLGQTCYLNVIL
QTLLHDPILNTYFLGNGHQPHDCTASDCVGCAVAEAFADFNSSDKPEGFAALNLLLASWR
ASSTLAGYQQQDAHEYYQFLVDKLHLSTENHREGHEKGCPCFFHKTFYGKLRSSVTCDKC
GNVTRTDDPMVDLSLDVQVQAKKRAMGGTGVPSTPTLSGCLESYTSPEKLMAGVYNCSHC
GGTPQKATKQLRIRKLPAILCMQLKRFEHTFSVSEKLEGKIDFPLSINMLPYTTSPQAKV
DRSRFVYDLSSAVVHQGKLDAGHYYVYCRQGDDWVLFNDDKVTAVTEAEVLNADAYLLFY
NLRSLASAPQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgtcctttcgatatcattactctctgaggccgaatatggctgcgagcacctg
gccacgcaactggggcaggatgtgagcactgcagagcagttcaagaacgcattcctgaaa
gcgcataattcattaggccatttcccgcggtcaatggagtcatccacaaagcagaacggt
cgtctcaaagccaaggactttctgaaaccgaagtacacttgcttgacatgcggtgaagcg
atgccgatgggcggccggaaagctcacaccgagaagaccagccatcagttctacatggag
tcgcgagcccgcacggtgtattgccaggcttgtggtgatttcgtctacgaccacggcctc
gaacgacttcggtgctcgacaacagaaagtgctcttcaagtcgccaagaagcgtcgcttc
agcgatagctctgcggacgagctttatattcggagcaatgccagcaagcgtccttgcgcc
aaacaaggcgtcaggggcttgttcaacctggggcaaacctgctatttgaatgtcattctt
cagacccttctgcacgacccgatactcaacacgtacttcctcgggaacggtcatcaaccc
cacgactgcactgcctctgactgcgtaggatgtgcagttgctgaggcttttgcggatttt
aacagcagcgacaaaccggagggtttcgcggctctcaatcttcttctagcatcatggcgt
gcaagttctactttggcaggatatcaacaacaagacgcacacgagtattaccagtttctc
gtcgacaagcttcaccttagtactgagaaccaccgagaaggccatgaaaagggttgtcct
tgcttctttcacaagaccttctacggcaagctccgaagcagcgtgacttgcgacaagtgt
ggtaacgtcacacgaacggatgatccgatggtggatctcagtctcgacgttcaagtgcag
gcgaagaaacgcgccatgggtggcacaggggttccgtcgacgcctaccctgagtggatgc
ctcgaaagctacacatctccagagaaactgatggcaggcgtgtataactgcagtcactgc
ggaggaacgccgcagaaggcgaccaaacaattgcgcatccggaagttacccgccattctg
tgcatgcaactaaagcgcttcgaacacaccttttccgtctcggagaagctagaaggcaaa
atcgacttcccactatcgatcaacatgctcccatatacgaccagcccgcaggccaaagtt
gacaggtctagattcgtatatgacctctcatcagccgtagtccatcagggcaagctcgat
gcggggcattactacgtctactgccgccagggcgatgattgggtgctcttcaacgacgac
aaagtcactgccgtcactgaggcagaagttctcaacgctgacgcttacctcttattctac
aaccttcgatcactggcttccgcgccacaatag

DBGET integrated database retrieval system