KEGG   Aspergillus niger: ANI_1_250024Help
Entry
ANI_1_250024      CDS       T01030                                 

Gene name
An02g01830
Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
ang  Aspergillus niger
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ANI_1_250024 (An02g01830)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MGKDASFAPGDSAKGAKLFQTRCAQCHTVEAGGPHKVGPNLNGLFGRKTGQAEGYAYTDA
NKQAGVTWDENSLFSYLENPKKFIPGTKMAFGGLKKGKERNDLITYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacgcttctttcgctcccggtgactccgccaagggtgctaagctcttccag
actcgttgcgctcagtgccacactgtcgaggctggtggtccccacaaggtcggccccaac
ttgaacggtctcttcggccgtaagaccggtcaggccgagggctacgcctacaccgacgcc
aacaagcaggctggtgtcacctgggatgagaactctctgttctcctacctcgagaacccc
aagaagttcatccccggtaccaagatggccttcggtggtctcaagaagggcaaggagagg
aacgacctcatcacttacctcaaggagagcaccgcttaa

DBGET integrated database retrieval system