KEGG   Aspergillus niger: ANI_1_2508074Help
Entry
ANI_1_2508074     CDS       T01030                                 

Gene name
An08g11070
Definition
(RefSeq) extracellular invertase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ang  Aspergillus niger
Pathway
ang00052  Galactose metabolism
ang00500  Starch and sucrose metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANI_1_2508074 (An08g11070)
   00500 Starch and sucrose metabolism
    ANI_1_2508074 (An08g11070)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ANI_1_2508074 (An08g11070)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 4983421
NCBI-ProteinID: XP_001393209
AA seq 628 aa AA seqDB search
MKLQTASVLLGSAAAASPSMQTRASVVIDYNVAPPNLSTLPNGSLFETWRPRAHVLPPNG
QIGDPCLHYTDPSTGLFHVGFLHDGSGISSATTDDLATYKDLNQGNQVIVPGGINDPVAV
FDGSVIPSGINGLPTLLYTSVSFLPIHWSIPYTRGSETQSLAVSSDGGSNFTKLDQGPVI
PGPPFAYNVTAFRDPYVFQNPTLDSLLHSKNNTWYTVISGGLHGKGPAQFLYRQYDPDFQ
YWEFLGQWWHEPTNSTWGNGTWAGRWAFNFETGNVFSLDEYGYNPHGQIFSTIGTEGSDQ
PVVPQLTSIHDMLWVSGNVSRNGSVSFTPNMAGFLDWGFSSYAAAGKVLPSTSLPSTKSG
APDRFISYVWLSGDLFEQAEGFPTNQQNWTGTLLLPRELRVLYIPNVVDNALARESGASW
QVVSSDSSAGTVELQTLGISIARETKAALLSGTSFTESDRTLNSSGVVPFKRSPSEKFFV
LSAQLSFPASARGSGLKSGFQILSSELESTTVYYQFSNESIIVDRSNTSAAARTTDGIDS
SAEAGKLRLFDVLNGGEQAIETLDLTLVVDNSVLEIYANGRFALSTWVRSWYANSTNISF
FQNGVGGVAFSNVTVSEGLYDAWPDRQS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcaaacggcttccgtactgctcggcagtgctgctgctgcctcgccttccatg
cagacgcgggcctccgttgtcatcgactacaatgtcgcacctccaaacctatccactctg
cccaatggctccctcttcgaaacatggcgtccccgcgcccacgtcctgccccccaacggc
cagatcggtgacccctgcctgcattacaccgatccctccacgggcctcttccacgtcggc
ttccttcacgatggcagcggcatctccagcgccaccactgatgatctagccacctacaag
gacctcaaccaaggcaaccaagtcattgttcccgggggtatcaacgaccccgtcgccgtc
ttcgatggctccgtcatccccagcggcatcaacggcctccccactctcctctacacctcc
gtctccttccttcccatccactggtccatcccctacacccgcggcagtgagacccaatcc
ctcgctgtctcctcggatggcggcagcaacttcaccaagctcgaccagggccccgtcatc
cctggccctcccttcgcctacaacgtcaccgcattccgggacccctacgtcttccaaaac
cccaccctcgactccctcctgcacagcaagaacaacacctggtataccgtcatctccggt
ggtctgcacggcaagggccccgcccagttcctctaccgccagtacgacccggacttccag
tactgggagttcctcggccaatggtggcacgagcccaccaactccacttggggtaacggc
acctgggccggccgatgggccttcaacttcgagaccggcaacgtcttcagtctcgacgag
tacggatacaacccccacggccagatcttctccacgatcggcaccgagggctctgaccag
cccgtcgtgccccagctcaccagcatccacgacatgctctgggtgtccggcaacgtctct
cgcaatggctctgtctcgttcaccccgaacatggcgggcttcctcgactggggcttctcc
tcttacgcagctgccggaaaggtcctcccctcgacttctctgccctcgacgaagagcggc
gccccggaccgcttcatctcgtacgtctggctgtccggtgacctgttcgaacaggccgaa
gggttccccacgaaccagcagaattggaccggtacgctgttgcttccgcgagagttgcgc
gtgctgtatatccccaatgtggtggacaatgctctggctcgggaatctggtgcctcgtgg
caggtcgtgagcagcgatagcagtgcgggcaccgtggagctgcagacactgggtatctcc
attgcccgggaaaccaaggccgccttgctgtcgggaacgtcgttcaccgagtccgaccgt
actctgaacagcagtggtgttgtgccgttcaagcgctccccgtccgagaagttctttgtt
ttgtccgcgcagctgtccttccctgcttcggctaggggatcgggactcaaaagtggattc
cagatcctctcgtcggagctggaaagcaccactgtctactaccagttctcgaatgagtcg
attattgtcgaccgcagtaacaccagtgctgcggcgcgtaccacggatggtatcgatagc
agtgcggaggctggcaagttgcgcctgtttgacgtgttgaatggcggagagcaggcgatt
gagacgttggatttgactctcgtggtggataactcggtattggagatctatgccaatggt
cggtttgcgttgagtacttgggttcgttcttggtacgccaattccacgaacatcagtttc
ttccagaatggcgtgggtggtgttgcgttctccaacgtgaccgtttccgagggcttgtat
gatgcttggccggatcgtcagtcttaa

DBGET integrated database retrieval system