KEGG   Aspergillus niger: ANI_1_258144Help
Entry
ANI_1_258144      CDS       T01030                                 

Gene name
An16g01840
Definition
histone deacetylase hda1
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     ANI_1_258144 (An16g01840)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ANI_1_258144 (An16g01840)
Messenger RNA biogenesis [BR:ang03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     ANI_1_258144 (An16g01840)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 800 aa AA seqDB search
MAMDEDEDTVMGEAGSHHPTSVSSHQWPSNGPSSQGAGQLNGSSDPSIAPPLLGPTMKLP
LSVHSGDPRPENTASAEDQGVSPPKSLPKSDSGDATTEDFDKQDSLVEDNSDWTDEDTVA
RTGLPIASLPSGLCYDVQMRYHCEVRPTADVHPEDPRRIYYIYKELCRAGLVDDPESCRP
LVSRPLKRINARNATEAEISLIHTPDHFAFVESTKDMSDDELIALEHTRDSIYFNKLTFA
SSILSVGGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKTMGFCLFNNVSVAARVCQNRL
GDSCRKILILDWDVHHGNGIQKAFYDDPNILYISLHVYQDGKFYPGGEEGDWDHCGEGPG
VGRNVNIPWPSQGMGDGDYMYAFQQVVMPIAHEFNPDLVIVASGFDAAAGDELGGCFVTP
SCYAHMTHMLMTLANGKVAVCLEGGYNFRSISKSALAVTKTLMGDPPDRLHTTSPSALAT
TTVRRVMMIQSHYWHCMYPKGPPQDGLFTDRLHDVIRAYQSKQLYDNYKLTSLFIYRTAI
SRSFENQVLASSNYHQTVPLVVIFHDPPEIMGLPHPVTNKLEAHNCWLADVMKDYIGWIV
SKGYAVIDVNIPKHVTIDPSSGKYEEEDENRPTATEELAGYLWDNYIEPSEATEIFFMGV
GNAFYGVANLLINRETLYKRVNSVVSFVAENPVRAIASHTQVWLSRWYKDNSLVFVSHTH
GVWNNVETRRKPSKRYGQLVQSPKASLSEMLMHHKEEVYQWISERADVQDSEETEDEKKP
KSKSRSPTKENQTEPRSVPG
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggatgaggacgaagacaccgtcatgggagaggcaggctcccaccaccccacc
tctgtttcttcacatcaatggccaagcaatggacccagtagccaaggtgctggccagctc
aatggtagttcggatccatctattgcaccgccactgctgggtccgaccatgaagctgccg
ttatctgtacactcgggagacccaaggcctgagaacacagcatcggcagaagatcaggga
gtgtcgccaccgaaaagcctccctaagtcagactccggtgacgcaactactgaagacttt
gacaagcaagatagccttgtcgaagacaactcggactggactgatgaggatactgtagcc
cgcactgggcttcccatcgcctcactcccttcggggttatgctatgacgttcagatgcgc
tatcactgtgaagtgcggccaacagcggacgttcatccagaggatcccagacgcatctac
tacatttacaaggaactttgtcgagcaggactagtcgatgatcccgaatcgtgccgtccg
cttgtctcaagaccactgaagcgcatcaacgctcgcaacgctactgaagcggagatatcg
cttattcatacgcctgaccattttgcatttgtagaaagcaccaaagacatgtctgatgat
gagctgattgcattggaacacacacgtgactcgatatactttaataaattgacgtttgca
tcttcgattctgtcagttggaggcgcgattgagacatgcttggctgtcgcaacccggaag
gtgaagaatgccattgcagtcatccggcctccggggcatcatgcagagcacgacaaaacc
atgggattttgtctgtttaacaatgtctctgtagcggcgcgtgtttgccagaaccgacta
ggtgacagctgcagaaagattttaattctcgactgggatgtccatcacgggaatggtatt
cagaaagccttctatgatgatcccaatatcctatacatctcactgcacgtgtatcaggat
gggaaattctaccctggaggggaagaaggtgactgggatcactgtggtgaaggccctggt
gtcggaagaaatgtgaatataccttggccgagccaagggatgggcgatggtgactatatg
tatgcctttcaacaagttgtcatgccaattgcccacgaatttaacccggatcttgtcatc
gttgcctctgggtttgatgcggctgcaggcgatgagcttggaggatgtttcgttacacct
tcgtgctacgctcacatgacacacatgctcatgacgcttgccaatggcaaggttgctgtt
tgtctcgaaggtggttataacttcaggtctatctccaagtcagcactcgcagtcacaaag
acactgatgggggacccgccggaccggcttcataccacctcaccttcagccctggccacc
acgactgtccggcgtgtgatgatgattcagtctcactattggcattgcatgtatcctaag
gggcctccccaagatgggctcttcaccgataggcttcatgatgtcatacgcgcctaccag
tcgaagcaactatacgacaactacaagctcacatctctcttcatatatcggaccgccatc
tcccggtcattcgaaaatcaggttctagcaagttccaattatcaccaaaccgtgccactt
gtagtgatattccacgatccgcctgagatcatgggcttgccccatccagtcaccaacaag
ctggaagcccataactgctggctggctgatgtcatgaaggactacattgggtggatcgtt
agcaaggggtatgcagtcatcgatgtcaacatccctaagcatgtgacaattgatccttca
tccggtaaatatgaggaagaagacgagaatcgtcccacggctactgaggaactggcgggc
tacctgtgggacaactatatcgaaccaagcgaggccaccgaaattttcttcatgggcgta
ggcaatgctttctacggagtagccaacctactgatcaatcgagaaacattgtataaacga
gtgaacagcgttgtttcctttgttgccgagaacccggttcgcgccatagcctcacacact
caggtttggctgtcgcggtggtacaaagataactcccttgtattcgtctcgcacacgcac
ggcgtctggaacaacgtcgaaacccggcgcaagccatccaagcgctacggccaactcgtc
cagtctcccaaagccagtctgagtgagatgctcatgcaccacaaggaagaggtataccaa
tggatatccgagcgtgcggatgtgcaggatagcgaggagacggaagatgagaagaagccc
aagtcgaagagccggtccccgacgaaggaaaaccagacggagccccgttcggtgccgggc
tga

DBGET integrated database retrieval system