KEGG   Aspergillus niger: ANI_1_258144Help
Entry
ANI_1_258144      CDS       T01030                                 

Gene name
An16g01840
Definition
histone deacetylase hda1
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ang  Aspergillus niger
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 800 aa AA seqDB search
MAMDEDEDTVMGEAGSHHPTSVSSHQWPSNGPSSQGAGQLNGSSDPSIAPPLLGPTMKLP
LSVHSGDPRPENTASAEDQGVSPPKSLPKSDSGDATTEDFDKQDSLVEDNSDWTDEDTVA
RTGLPIASLPSGLCYDVQMRYHCEVRPTADVHPEDPRRIYYIYKELCRAGLVDDPESCRP
LVSRPLKRINARNATEAEISLIHTPDHFAFVESTKDMSDDELIALEHTRDSIYFNKLTFA
SSILSVGGAIETCLAVATRKVKNAIAVIRPPGHHAEHDKTMGFCLFNNVSVAARVCQNRL
GDSCRKILILDWDVHHGNGIQKAFYDDPNILYISLHVYQDGKFYPGGEEGDWDHCGEGPG
VGRNVNIPWPSQGMGDGDYMYAFQQVVMPIAHEFNPDLVIVASGFDAAAGDELGGCFVTP
SCYAHMTHMLMTLANGKVAVCLEGGYNFRSISKSALAVTKTLMGDPPDRLHTTSPSALAT
TTVRRVMMIQSHYWHCMYPKGPPQDGLFTDRLHDVIRAYQSKQLYDNYKLTSLFIYRTAI
SRSFENQVLASSNYHQTVPLVVIFHDPPEIMGLPHPVTNKLEAHNCWLADVMKDYIGWIV
SKGYAVIDVNIPKHVTIDPSSGKYEEEDENRPTATEELAGYLWDNYIEPSEATEIFFMGV
GNAFYGVANLLINRETLYKRVNSVVSFVAENPVRAIASHTQVWLSRWYKDNSLVFVSHTH
GVWNNVETRRKPSKRYGQLVQSPKASLSEMLMHHKEEVYQWISERADVQDSEETEDEKKP
KSKSRSPTKENQTEPRSVPG
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggatgaggacgaagacaccgtcatgggagaggcaggctcccaccaccccacc
tctgtttcttcacatcaatggccaagcaatggacccagtagccaaggtgctggccagctc
aatggtagttcggatccatctattgcaccgccactgctgggtccgaccatgaagctgccg
ttatctgtacactcgggagacccaaggcctgagaacacagcatcggcagaagatcaggga
gtgtcgccaccgaaaagcctccctaagtcagactccggtgacgcaactactgaagacttt
gacaagcaagatagccttgtcgaagacaactcggactggactgatgaggatactgtagcc
cgcactgggcttcccatcgcctcactcccttcggggttatgctatgacgttcagatgcgc
tatcactgtgaagtgcggccaacagcggacgttcatccagaggatcccagacgcatctac
tacatttacaaggaactttgtcgagcaggactagtcgatgatcccgaatcgtgccgtccg
cttgtctcaagaccactgaagcgcatcaacgctcgcaacgctactgaagcggagatatcg
cttattcatacgcctgaccattttgcatttgtagaaagcaccaaagacatgtctgatgat
gagctgattgcattggaacacacacgtgactcgatatactttaataaattgacgtttgca
tcttcgattctgtcagttggaggcgcgattgagacatgcttggctgtcgcaacccggaag
gtgaagaatgccattgcagtcatccggcctccggggcatcatgcagagcacgacaaaacc
atgggattttgtctgtttaacaatgtctctgtagcggcgcgtgtttgccagaaccgacta
ggtgacagctgcagaaagattttaattctcgactgggatgtccatcacgggaatggtatt
cagaaagccttctatgatgatcccaatatcctatacatctcactgcacgtgtatcaggat
gggaaattctaccctggaggggaagaaggtgactgggatcactgtggtgaaggccctggt
gtcggaagaaatgtgaatataccttggccgagccaagggatgggcgatggtgactatatg
tatgcctttcaacaagttgtcatgccaattgcccacgaatttaacccggatcttgtcatc
gttgcctctgggtttgatgcggctgcaggcgatgagcttggaggatgtttcgttacacct
tcgtgctacgctcacatgacacacatgctcatgacgcttgccaatggcaaggttgctgtt
tgtctcgaaggtggttataacttcaggtctatctccaagtcagcactcgcagtcacaaag
acactgatgggggacccgccggaccggcttcataccacctcaccttcagccctggccacc
acgactgtccggcgtgtgatgatgattcagtctcactattggcattgcatgtatcctaag
gggcctccccaagatgggctcttcaccgataggcttcatgatgtcatacgcgcctaccag
tcgaagcaactatacgacaactacaagctcacatctctcttcatatatcggaccgccatc
tcccggtcattcgaaaatcaggttctagcaagttccaattatcaccaaaccgtgccactt
gtagtgatattccacgatccgcctgagatcatgggcttgccccatccagtcaccaacaag
ctggaagcccataactgctggctggctgatgtcatgaaggactacattgggtggatcgtt
agcaaggggtatgcagtcatcgatgtcaacatccctaagcatgtgacaattgatccttca
tccggtaaatatgaggaagaagacgagaatcgtcccacggctactgaggaactggcgggc
tacctgtgggacaactatatcgaaccaagcgaggccaccgaaattttcttcatgggcgta
ggcaatgctttctacggagtagccaacctactgatcaatcgagaaacattgtataaacga
gtgaacagcgttgtttcctttgttgccgagaacccggttcgcgccatagcctcacacact
caggtttggctgtcgcggtggtacaaagataactcccttgtattcgtctcgcacacgcac
ggcgtctggaacaacgtcgaaacccggcgcaagccatccaagcgctacggccaactcgtc
cagtctcccaaagccagtctgagtgagatgctcatgcaccacaaggaagaggtataccaa
tggatatccgagcgtgcggatgtgcaggatagcgaggagacggaagatgagaagaagccc
aagtcgaagagccggtccccgacgaaggaaaaccagacggagccccgttcggtgccgggc
tga

DBGET integrated database retrieval system