KEGG   Aspergillus niger: ANI_1_26034Help
Entry
ANI_1_26034       CDS       T01030                                 

Gene name
An03g00280
Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANI_1_26034 (An03g00280)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ANI_1_26034 (An03g00280)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     ANI_1_26034 (An03g00280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MRLSILSAAIAALTVTPVSAATQDPVDVLASKALATKRAYLATEGSSNSSCNINNAAVRK
EWGSLAPEDRKKYTDAVLCLMSKPPRSDPNWAPGARNRFDDFVAVHINQTLYIHGTGNFL
TWHRYFTWAYENALRTECGYDGYQPYWAWNKYAANPINSPVFDGTEYSMSGNGDFVPHNG
TPATDYTIIPPGVGGGCVRNGPFANMTVNLGPVDPTLQIPGLVAQNGSGLDYNPRCLRRD
ISPWTALGWTKSSDVMSLIEKCDNISCFEWTMQGFFEEGFLGVHTAGHFTIGGDPGGDLY
TSPGDPAFYVHHAMIDRVFWIWQNLNPANRTYVVKGPDFIDGLIASPNTTIHDLLYMGNL
TVSREIYDVLDTTAGTPLCYIYE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctctattctatctgctgctattgcagctctgactgtcactcctgtgtcggca
gctactcaagatcctgtcgatgtgctggctagcaaggccttggccaccaagcgcgcttat
ctggcgactgagggctcttccaactccagctgcaacatcaacaatgcggctgttcgcaaa
gaatggggctccctcgcgccggaggaccgcaagaagtacacagatgctgttctttgcttg
atgtccaagccccccaggtctgacccgaactgggctcctggtgcccggaaccgttttgat
gactttgtggcggttcacatcaaccagacgctgtatattcatggcacagggaacttcctc
acctggcaccgctacttcacctgggcctatgagaatgctctgcgtacagagtgtggctac
gatggatatcagccatactgggcatggaacaagtacgctgccaaccccatcaactcgccc
gtatttgacggcaccgagtacagcatgtctggtaatggcgacttcgttccccacaatggc
acccctgcgactgactataccatcatcccaccgggtgtcggtggaggttgtgtccgcaac
ggccccttcgccaacatgaccgtcaacctgggaccggttgatcctaccctgcagatccct
ggcctcgtagcccaaaatggcagtggcttggattacaacccccgttgtctgcgccgtgac
atctccccttggaccgctctgggctggaccaagtctagcgatgtcatgagcctgattgag
aagtgcgacaacatctcctgcttcgagtggaccatgcaagggttcttcgaggaaggtttc
ctgggcgttcacacggccggccacttcaccattggtggtgacccgggtggtgatctgtac
acttcccccggtgatccggcattctatgtccaccacgctatgattgaccgcgtcttctgg
atctggcagaacctgaaccctgctaaccggacctacgtcgtcaagggaccagacttcatt
gatggtctgattgcatcgcccaacactaccattcatgacttgctctacatgggtaatctg
acagtctcgcgggagatttatgacgtgctggacaccacggctggcactcctctgtgctat
atttatgagtaa

DBGET integrated database retrieval system