KEGG   Aspergillus niger: ANI_1_2608094Help
Entry
ANI_1_2608094     CDS       T01030                                 

Gene name
An11g11260
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ANI_1_2608094 (An11g11260)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 261 aa AA seqDB search
MLKKTPISVSSLPKKLLQRSLSMAWYCSGSTNSELIANLFKTGLIKDERVKNAMLGVDRA
HYAPSRPYSDSPQPIGHGATISAPHMHGHACEYLIDYLKPGSRVLDIGSGSGYLTHVLAN
LVVDPSSTSEADGQVIGVDHIPELVELAQTNMRKSKDGSNFLDSGRVKFITADGRLGWKE
GAPYDAIHVGAAAHHLHPVLIEQLRAPGRMFIPVDAEDDEASFGLGGGQYIWVVDKSGDG
SVRKEKVFQVSYVPLTDRPGR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagaagacacccataagcgtgtcttcattacccaagaagcttctgcaaaggtcc
ttgtcaatggcgtggtattgctctggctccacgaatagcgagcttatcgcgaacctgttc
aagacgggtctgataaaagatgaaagagtgaagaatgccatgctaggcgtcgatcgcgcc
cattatgccccctcaaggccatactcagattcaccgcagcccatcggacatggagctacc
atctctgctcctcacatgcatggacatgcctgcgaatacctcatcgattacctgaagcca
ggctcgcgtgtgctggacatcgggtctggttcgggttacctcacccacgtgcttgcaaac
ctcgtcgtggatccttcgtccacgagcgaagccgatggccaggttataggtgtagaccac
attccggagttggtggaactggcacaaacaaacatgcgcaaatcgaaagatggcagcaac
ttccttgactccggaagggtgaaattcatcaccgccgatggtcgtctgggctggaaagaa
ggtgcaccgtacgacgccatccatgttggcgcggccgcgcatcatcttcaccccgtactc
atcgagcagctccgcgcaccagggcgaatgttcatacccgttgacgcggaggatgatgag
gctagctttgggctggggggcggacaatatatctgggtagttgataaaagtggggatggt
tcggtccgcaaggaaaaagtattccaggttagctacgttcctctaactgaccgcccggga
agataa

DBGET integrated database retrieval system