KEGG   Aspergillus niger: ANI_1_2654014Help
Entry
ANI_1_2654014     CDS       T01030                                 

Gene name
An01g06820
Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ang  Aspergillus niger
Pathway
Fatty acid degradation
Tryptophan metabolism
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ang00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ang00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1064 aa AA seqDB search
MSDAKIIPIPGPRPLPLLGNILDFDLDNLTQSLDRLSKAHGPIYALTFGSSTEIMVTSRR
IAEELCDETRFCKLVAGGLEKMKPVVGDGLFTAQSDDPKWAIAHRILMPLFGTMKIREMF
NDMKDICEQMCLKWARLGESFPLDVCKNFTTLTLDTISLCTIDYRFNSFYRDGKEDPFVE
AVIAVMTDAFTQSNLPDFVNNWFRHKAMADFHDHAQNLRRRTEEIIQERRRSPVERNDLL
NAMLTAVDPKTGERLSDQSVVDNLLTFLIAGHETTSSLLSFCFYYLLENPDVLQKARDEV
DQVIGDGPMMVEHLQKLPYIESILRETLRLRDPGPGFYLKPLKDDILDGKYYVKKDQPIF
IVFDSVHRDPETYGSDANNFRPSRMSQENFEKLPPCAWKPFGNGVRSCIGRPFAWQQSLL
AVAMILQNFDLIKDETYKLKYHVTMTVRPVGFHMKVRLRRQRRATDFAQKLHAPVASQVP
LINHHQSIRPNTVEGSRITILHGSNAGSCEALALRLAADAGEYGFTRSKIEPLGSAVGKL
PTDNPVIIITASYNGEPADEASDFVAWLKTAGRDELSGVSFSVFGCGHRDWASTYFAVPK
LLDAEMERAGGRRIAPLGTADSATSDLFTDLEKWSVTHLFPELGSTEHIRRDAEGVKVSS
SCQVMLSDPPRVTLRKGFVPTSITESRCLSQPGVPEKRHLELRLPDGFTYQPGDHLYVLP
RNSPQNVQRVLSRFHLEGDMLLTLTRSQSLGLPVNTPISASDLFGAYVELRQIASPKGIL
ALADSTPDSCTQTILRDLAGDLFKVEIQDKYVSVLDLLERFPTINPSIGLFLSLLTPMRP
RAYSFSSSPNEKPGYGTLTYTVVGSVVHDGEASAVQGIASNHLATLRHHATLYIALHPCT
AEFRLPSDNSRPLVMVAAGTGLAPFRGFIQERRFRQLAGKKVGPALLFYGCRGRDLDDMY
RDEMDGYEKEGVVSIHRAYSRVKGADFRYIDSAIARFLDHVVSLWASGGVVRVCGGKKMS
NSVFEVLGPALLERDRLDGKTDVTDVAEWKRNLPRGRYVEEIFL
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgcaaaaattatcccaattcctggcccgagacctcttccgcttttaggaaac
attctagactttgacctagacaacctaacgcagtcacttgatcggctgagcaaagcacat
ggcccgatatacgcccttactttcggatcctcaacagagatcatggtgacaagcaggagg
attgcagaagagctgtgcgatgaaacacgattttgcaagttggtggcaggcggcctggaa
aagatgaagccggtggttggagacggactctttaccgcccaaagcgacgatcccaaatgg
gcaatagcacatcgcatccttatgccactttttggcaccatgaagatccgggagatgttc
aatgacatgaaagacatatgcgagcagatgtgtttgaaatgggcgcgtcttggggaatcc
tttcctttggacgtgtgcaaaaacttcacgaccttgaccttggatacgatcagtctctgt
accatcgattaccgcttcaacagtttttatcgggacggaaaggaggatccgttcgtagaa
gcagtcatagctgtcatgaccgatgcttttacgcagtccaatctgcccgattttgtcaac
aactggttccgacataaggccatggctgatttccatgaccatgcgcagaatctgcgtcga
cgaacggaagagatcattcaagaacgccgcagatcccccgtggaaaggaatgatcttttg
aacgcaatgctcactgcagtcgaccccaaaacgggagagcggttgagcgaccagtcggta
gtggataatctcttgacattcctcattgcaggacatgagaccacttcaagtctactttca
ttctgcttctattatctgcttgagaaccccgatgttcttcaaaaggctcgtgacgaggtt
gaccaagtgattggggacggccccatgatggttgagcacctccaaaaacttccatacatt
gaatcgatcttgcgagagactcttcggctgcgagatccggggccaggtttttatcttaag
cctctgaaggatgacatcttagatggaaagtattatgtgaagaaggatcaacccatattc
atcgtctttgattcagtgcaccgggaccccgagacctacggctctgatgcgaacaatttc
agacccagtcgaatgtcacaggaaaacttcgagaagcttccaccctgtgcatggaagccg
ttcggaaacggagtgcgtagctgcattggaaggccctttgcatggcagcaatctcttctt
gctgtggcgatgattctgcagaattttgatttgattaaggatgagacctataagcttaag
taccatgtaaccatgacagttcgacctgtcggcttccacatgaaggtgcgtcttcgacgt
cagaggcgagcgaccgactttgcccagaaacttcacgctcctgtagcctcgcaggtacca
ctgatcaaccaccatcagtcaatccgtccgaatactgttgaaggatcacggataaccata
ttacacggttctaatgctggaagctgtgaggccctggcacttcgcctggcagctgatgcc
ggagaatatggattcactagaagcaagattgaaccactgggatcggccgtcggcaagcta
ccaacagataatccggtcatcattatcacggcttcttacaacggcgagccagcagatgaa
gcgtctgactttgtagcttggttgaaaactgcaggacgtgacgaattaagtggcgtttca
ttttccgttttcggctgcggtcatcgtgactgggcaagcacgtacttcgcagtgcctaag
ttgcttgatgctgagatggagcgagcaggggggagaaggatcgcccctctaggtacagca
gattccgcaacgagcgatctgtttacagatcttgaaaaatggtccgtcacacatctgttc
ccggagttaggaagcaccgagcacatacgaagagatgcggagggtgtcaaggtgtcgtca
agttgtcaagtcatgctcagcgatccaccacgggtcactctacggaagggatttgttccg
acgagtatcacagagtcccggtgcctctcacaacctggagttcccgaaaagcgacatctg
gaacttcgtctcccagacgggtttacttaccaaccgggtgatcatctttatgtccttccc
cgtaacagccctcaaaatgttcagcgtgtcctgtcaagattccatcttgagggtgatatg
ctcctcactttgactagatcccaatctctgggactccctgtcaataccccaatctcagcc
tcggacctgttcggcgcctacgttgagctccggcagattgccagtccaaaaggcatcctt
gccttggccgattccacccctgatagttgcactcaaacaatactgagagacttggccggt
gatctcttcaaagtcgagatacaagataaatatgtttctgtcttggatcttctggaacgt
ttcccgacgattaatccttccattgggctctttctatctcttctcacacctatgcggcca
cgggcctattccttctcgtcctctccaaacgaaaagccaggatatggaacgctaacctat
actgtcgtgggatccgttgtacatgatggggaagctagcgcagtacagggaatcgcatcg
aatcacttagccactttacgccatcatgcgaccctctacatagcgctacacccttgtaca
gcagaatttcgtctcccttctgataattctagacccttggtcatggtagccgctgggaca
ggcttagctcccttcagaggattcatccaggagcgcaggttccgacaattggccggcaag
aaggttggtcctgcgctgctcttctatggatgtcgcggaagagatctagatgatatgtac
cgagacgagatggatgggtatgaaaaggagggtgtggtcagtatccatcgagcgtatagt
cgtgtaaagggtgcagatttcaggtacatcgactctgcgatagcgagatttctcgatcac
gtggtatcactatgggccagtggcggcgttgttagggtctgtggagggaagaagatgtcg
aactcggtcttcgaagtgctaggtcctgcgttgctggaacgggataggctcgatggcaag
actgacgtaacggatgtggcagagtggaagcgcaaccttccgcgcgggagatatgttgag
gagatatttctgtag

DBGET integrated database retrieval system