KEGG   Aspergillus niger: ANI_1_2692024Help
Entry
ANI_1_2692024     CDS       T01030                                 

Gene name
An02g07490
Definition
ubiquitin carboxyl-terminal hydrolase 16
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ANI_1_2692024 (An02g07490)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_2692024 (An02g07490)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 608 aa AA seqDB search
MQEKSSTVAAYAAGASLAAIALFYVFGPNYTIDGDESQDSSRKKNIVGLSNPANDCFINS
VLQALAGLGDLRVYLIRELHKRELDGSDIYNELPPPADMPRDAKPDRIRELQQGSITRAL
KEMLDRLNERPIYKKTISARPFIQSLEYAYRTRISRSQQDAQEFLQIVAERLCDEYHAGV
KARLRAKAIPELSSGPEAVKSGDESSPKVPAEVEVRIDDGSENGLPAIIDNKLKEIDHEY
GFPFEGKLESQIECLFCHYQYKPNQTSFVNLTLQVPQKSSTTLSACFDGLLKTEYIEDFK
CDKCRLQHALEFKTQELHRTRSKDDRARFESEIERIQTALATNPEGPLEGVILPPSDLAP
KRKIARHMRITAFPKIIAIHLSRSIFDHSSSSKNAAKVSFPERLPLGGILSREWYRLLAI
VCHKGSHHSGHYESFRRNHLYPPFSTPDVFSSYAQSRATSENPSEAPSPQLKARNSFESE
PAPLSISTSIGSPTSPSQLQPPPSPTPRPTSSPRVSFQSTRSKSSASKQNLSPVSDPHSS
SSTEGGRWSKSFSRASFTSDRSSSSRLRRRRKQNDRWWRVSDEKVKECKTSDSVQGAPGT
ASRPNNTP
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaaatcgagcactgtcgccgcttacgcggccggagcatctcttgcggctatt
gctttattctacgtcttcggccccaactacactatcgatggagacgagtcacaggacagt
tcccgcaagaaaaacattgttggcttgtccaaccccgccaatgactgcttcatcaactcg
gtgctgcaggctcttgcagggctcggtgatctgcgtgtctacctgatcagagagctccac
aagcgtgaactagacggttctgatatatataatgaacttcctccaccggctgatatgcct
cgggatgcgaagccggacaggataagggaattgcaacaggggagtattaccagagctctc
aaggagatgctcgaccgactgaacgaacgcccgatctacaagaaaaccatctccgcgcga
cccttcatccagtctcttgagtacgcctatcggacgcggatcagccgtagccagcaagat
gcgcaggagttcttgcagattgtcgcagaaagactttgcgatgagtaccatgccggcgtg
aaagcacgactacgagcgaaggccataccagagttgtcgtcaggcccggaggcggtaaaa
tcaggcgatgaatcttctcccaaagtccctgcggaagttgaggtgcggattgatgacgga
tctgagaacggcttacccgctattatcgacaataaactcaaagaaatcgaccatgagtac
ggcttccctttcgaaggaaagctcgagtcccagatcgagtgcctgttttgccactatcaa
tacaagcctaatcagacctcctttgtaaatctgaccttgcaagtgcctcaaaagagctct
acgacgcttagcgcctgctttgacggtttactcaaaactgaatacattgaagacttcaaa
tgcgacaaatgtcgattgcagcatgctcttgagttcaagacgcaggaattgcaccggacc
cgctccaaagatgaccgagctaggtttgagtcagaaattgagcgaatccagacggccctc
gctacaaatccagaaggtcctttagagggtgtaatcttgccaccttctgacctcgcccct
aaacgaaagattgcgagacatatgcggataacggcctttcccaaaatcattgccattcat
ctttcgcgatcgatctttgaccacagcagctcttccaagaatgcagccaaagtatctttt
ccggagcggctgccgctcggtggtatcctgagtcgagaatggtacaggctgctggcaatt
gtctgtcataaaggcagccaccatagcggacattacgagtcatttcgacgtaatcacctt
tatccacccttctcaacgccagatgtattcagctcgtacgctcagagtcgggcaactagc
gaaaacccatccgaagcgccgagccctcagctaaaggctcgcaactcgttcgagagcgaa
ccggcgcccctcagcatctcgacatcgatagggtcaccgaccagtccctctcagctgcaa
ccgcccccgtcaccgactcctcgaccgacatcgagcccacgggtttctttccagagcact
cgctcgaagtcgtcagcatctaagcagaacctatcgcccgtgtcagacccgcacagctca
tcctccacagagggtgggcgctggagcaagtcattttcgcgcgcgtcgttcaccagcgat
cgcagctccagcagtcggctccgtcgacgccgtaagcagaacgatcgatggtggcgtgtc
tcggacgagaaagtcaaagaatgcaagacttccgattcagtgcagggagcccccgggacc
gcctcccgtcccaacaacactccctga

DBGET integrated database retrieval system