KEGG   Aspergillus niger: ANI_1_2704024Help
Entry
ANI_1_2704024     CDS       T01030                                 

Gene name
An02g07590
Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ang  Aspergillus niger
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ang00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ang00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 859 aa AA seqDB search
MPATGLQKQIGQLFAVGFHGLTPSPEIKTLIHDYGIGAIVLFKRNVSDAAQLQALTHALQ
EEARLAGHEHPLLIGIDQENGLVTRVSPPVAPQLPGPMALGAANSPELAYQVGAATGEIL
SASGINMNYAPVCDINSEPLNPVIGVRSFGDNPEFVARFASASAQGLREHKVVPTVKHFP
GHGDTAVDSHYGLPVIPKTREQLESCELVPFRQAANEGIEAIMTAHISLPAIGDGRLPAT
LSPDVMRILREDMGYSGMVITDCLEMDGIRATYGTEQGAVLALAAGCDSIMICHTYSVQV
ASILQVCQAAESGKIPSARLDEAIRRVSELKSRFLSWETALRPLESRENWPALGADLVKH
SALAKQAYAQSVTLVRDSLQILPVSSSANVVFLFPGDQTPAGGAVDGEGLGRKGSYNASV
YLNILRQYNQTVVEIRYGAAGLSAELTSTIEAADVVIFTSINARESPFQRTLGLELPSRA
RKLVSIAACNPYDFLEDASVGTYIATYEPTPEAFAAAAEVIFGKSEPKGILPVKNPPSQM
SVEESALTNTKDILQITDVWNAALPSYSLSAQKLQLLINQEHGHHFVARLGADIVGFGLT
YTSTTPAGVAGNIAVLAVDPAKQGQGLGTALISKITAWYRANLNLSRLELSSSFPRFFPG
IPNDLPSSVQEFFQKRGFSLWDTNPRNVDLYQDIGDFKAPDAYITRAADQGYTFGPLQPE
HYEECLAGQRKNFSANAAWVRQYEELHPTKYPFSVMAAFDSQGKQAAWTLMLGPDSPALQ
RNWALPPVCGPKTGLIGCVGVDADHRKKGLGLALLSHAMEDLRQRGAEGVFVDWVVLEGF
YEQLGFKVWREYRRATLQM
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgactggactgcagaagcaaattggtcagctcttcgcggtcggattccacggc
ctcaccccgagcccagaaatcaagactttgattcacgactatggtattggtgcgatcgtt
cttttcaaacgaaatgttagcgatgcagctcaacttcaggccttgacgcatgcgctccaa
gaagaagcacgattagcaggacacgaacatcctttgcttatagggattgatcaggagaat
ggtcttgtcactagggtatcgcctccggttgctccacaactgccgggccctatggctcta
ggtgccgccaactcccccgagctcgcataccaggtcggggcggcaaccggtgagattctg
agcgcctcgggaattaacatgaactatgcgcccgtatgtgacattaattccgagccactc
aacccggtaatcggggttcgtagcttcggagataatcccgagttcgtggctcgattcgcc
agtgccagcgcccaaggtcttcgggagcacaaggtcgtacctactgtaaaacatttccca
gggcatggtgataccgcagttgactcccactatggcctacctgtcattccaaagacacga
gaacaactagaaagctgcgagctggttcccttccgtcaagcagcaaatgaaggtatcgag
gcaattatgacagcccatatctccctacctgccataggagatggcagattgcctgccacc
ttatcgcctgatgtgatgaggattcttcgcgaagatatggggtacagtggtatggtcatt
acggactgtctcgagatggatggaattcgtgctacgtacggaacagagcaaggcgctgtc
cttgctctggcggctggctgcgacagcattatgatatgccacacgtattccgtccaagta
gcttctattctgcaggtctgtcaggccgccgagtctggaaagattccttccgcgcgattg
gatgaggccatccgtcgtgtgagtgagctgaagagcagatttctaagctgggagacggcg
ctgcgacctctggaatcgagagaaaactggcctgctctgggagcagatttagtgaaacat
tctgcgctggctaaacaagcctatgcccagtctgtgacgcttgttcgggattccctccag
attcttcctgtgtccagctctgctaacgtcgtattcctctttcctggggaccagactcca
gctggaggtgcagtggatggagagggactgggaagaaagggctcttataacgcctccgtt
tacctcaacatactgaggcaatacaaccaaacggtggttgagatccgatatggggctgca
ggcttatcggccgagctgacgagtaccattgaagctgccgatgtcgttattttcacttct
attaatgcgcgagagtctccgtttcagcggactttaggcttggagctgcctagccgggct
cgtaaactggtcagcatcgccgcctgtaacccctatgacttcctggaagatgcgtcggtt
ggaacatatatcgccacctatgagccaacacccgaagcatttgcggcagctgctgaggtc
atatttggaaaatcggaacctaaaggcatcttgccggtcaaaaatcctcctagtcaaatg
tctgttgaggaatcagcattgactaacactaaggatatcttgcaaataacagatgtttgg
aatgctgctttgccttcctactcactttccgctcagaagttgcaactacttataaaccaa
gaacatgggcaccatttcgttgctcgcttgggtgctgatattgtaggatttggcttgaca
tataccagcactacacccgcaggtgttgctggcaacattgctgtgcttgcagtggatcct
gcaaagcaaggccagggacttggaacagcactgatctcgaaaatcactgcatggtatcgg
gccaatctgaatctgtcacgtctcgaattaagcagctcattcccaaggttctttcctggg
atacccaacgatttaccgtcatcggtacaggagttcttccagaagcgtggcttctcacta
tgggatacgaacccgcggaacgttgacctgtaccaagatataggtgacttcaaggctcct
gacgcatatatcactcgggctgcggatcagggatatacgtttggtccacttcagcccgag
cattatgaagaatgcctggctggacagaggaaaaatttctctgcaaatgcggcctgggtg
cgccaatatgaagagcttcaccctaccaaatatccattcagtgtgatggcagccttcgac
tcccaaggaaagcaggccgcttggacactgatgcttggtcctgactcgcccgctctacag
agaaactgggcgcttccacctgtgtgtgggcccaaaactggcctcattggatgtgtaggt
gtggatgcggatcataggaagaagggacttgggctggcactactcagccacgcaatggag
gatctgaggcagagaggcgcggagggagtatttgtcgactgggtggtgctggaagggttc
tacgagcagctcggcttcaaagtctggcgcgaatatcgacgggcaactcttcaaatgtag

DBGET integrated database retrieval system