KEGG   Aspergillus niger: ANI_1_2706014Help
Entry
ANI_1_2706014     CDS       T01030                                 

Gene name
An01g07220
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ang  Aspergillus niger
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ang03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MPELAEVSRIVHFLRQHLVGKTLSKVSVQNDDIIYGKAGTTAAEFQKAMEGKKVTGAGQQ
GKYFWIAMSSPPHAVMHFGMAGWLKIRDADTYYYRTDKPGDKEWPPKYWKFLLETEGDPK
TEAAFVDFRRLGRIRLVDCPAEEIRNYSPLKENGPDPVADKDIVSEEWLAKKLRSKKVPV
KALLLDQANISGIGNWMGDEILYQAKIHPEQYSNTLDDDQIRELHSAIHYICSTSVELLA
DSEKFPADWLFKHRWSKGKKNTPSVLPNGEKITFLTVGGRTSAVVPSVQKKTGPVAKDVS
SEDASNAPANSKRKRASVKKEESEPEASEEDTKPKKTGPKRQSRTSVKKEDIDETETKPI
EEQQTTRRRSDRLRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctagcggaagtctcgcgtatagtccatttccttcgtcaacatcttgtcggc
aaaacgctttccaaggtgtcagtgcaaaacgatgacattatctacggcaaagccggtact
actgctgccgagtttcagaaggcaatggaggggaagaaagttactggtgccggacagcag
ggcaagtacttctggattgctatgtcatcaccaccccatgcggttatgcatttcggtatg
gcgggctggctgaaaatccgggatgccgacacctattactaccggacagacaaacctgga
gataaggagtggccgccaaaatactggaaattcttgctcgaaaccgagggagatccaaag
acagaagctgcttttgttgactttcgccgactgggcagaatacgcctggtagactgtccc
gcggaggaaatccgtaactacagccctctgaaagagaatggcccagatcctgtcgccgat
aaagacattgtgtcggaggagtggctggcaaagaagctccgaagcaagaaggtacctgtg
aaggcgctgctccttgatcaagcgaatatcagcggaataggcaactggatgggcgatgag
atcctctaccaagctaaaatacaccctgagcaatacagcaacactttggatgacgaccag
attagagagctgcactcagcgatacattatatctgttccacctccgtagagcttctagca
gattcggagaaatttccagctgactggctgttcaaacatcggtggagtaaaggcaagaag
aacacgccatcagtgctgccaaacggagaaaagattacctttctcacggtagggggcagg
accagcgcagtggttccgagtgtgcagaaaaaaactgggccagtagccaaggacgtcagc
agtgaagacgccagcaatgcgccggcaaactcgaagcgaaagcgggcttcagtgaaaaag
gaggagagcgagccggaagctagcgaagaggatacgaagcccaagaagaccgggcccaaa
aggcaaagcagaacttctgtcaagaaggaagacatcgatgagacagagactaagccgata
gaagaacagcaaactaccaggagacgctcggaccgacttcgaaagtag

DBGET integrated database retrieval system