KEGG   Aspergillus niger: ANI_1_2706014Help
Entry
ANI_1_2706014     CDS       T01030                                 

Gene name
An01g07220
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ang  Aspergillus niger
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ANI_1_2706014 (An01g07220)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ANI_1_2706014 (An01g07220)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ANI_1_2706014 (An01g07220)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 375 aa AA seqDB search
MPELAEVSRIVHFLRQHLVGKTLSKVSVQNDDIIYGKAGTTAAEFQKAMEGKKVTGAGQQ
GKYFWIAMSSPPHAVMHFGMAGWLKIRDADTYYYRTDKPGDKEWPPKYWKFLLETEGDPK
TEAAFVDFRRLGRIRLVDCPAEEIRNYSPLKENGPDPVADKDIVSEEWLAKKLRSKKVPV
KALLLDQANISGIGNWMGDEILYQAKIHPEQYSNTLDDDQIRELHSAIHYICSTSVELLA
DSEKFPADWLFKHRWSKGKKNTPSVLPNGEKITFLTVGGRTSAVVPSVQKKTGPVAKDVS
SEDASNAPANSKRKRASVKKEESEPEASEEDTKPKKTGPKRQSRTSVKKEDIDETETKPI
EEQQTTRRRSDRLRK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctagcggaagtctcgcgtatagtccatttccttcgtcaacatcttgtcggc
aaaacgctttccaaggtgtcagtgcaaaacgatgacattatctacggcaaagccggtact
actgctgccgagtttcagaaggcaatggaggggaagaaagttactggtgccggacagcag
ggcaagtacttctggattgctatgtcatcaccaccccatgcggttatgcatttcggtatg
gcgggctggctgaaaatccgggatgccgacacctattactaccggacagacaaacctgga
gataaggagtggccgccaaaatactggaaattcttgctcgaaaccgagggagatccaaag
acagaagctgcttttgttgactttcgccgactgggcagaatacgcctggtagactgtccc
gcggaggaaatccgtaactacagccctctgaaagagaatggcccagatcctgtcgccgat
aaagacattgtgtcggaggagtggctggcaaagaagctccgaagcaagaaggtacctgtg
aaggcgctgctccttgatcaagcgaatatcagcggaataggcaactggatgggcgatgag
atcctctaccaagctaaaatacaccctgagcaatacagcaacactttggatgacgaccag
attagagagctgcactcagcgatacattatatctgttccacctccgtagagcttctagca
gattcggagaaatttccagctgactggctgttcaaacatcggtggagtaaaggcaagaag
aacacgccatcagtgctgccaaacggagaaaagattacctttctcacggtagggggcagg
accagcgcagtggttccgagtgtgcagaaaaaaactgggccagtagccaaggacgtcagc
agtgaagacgccagcaatgcgccggcaaactcgaagcgaaagcgggcttcagtgaaaaag
gaggagagcgagccggaagctagcgaagaggatacgaagcccaagaagaccgggcccaaa
aggcaaagcagaacttctgtcaagaaggaagacatcgatgagacagagactaagccgata
gaagaacagcaaactaccaggagacgctcggaccgacttcgaaagtag

DBGET integrated database retrieval system