KEGG   Aspergillus niger: ANI_1_274064Help
Entry
ANI_1_274064      CDS       T01030                                 

Gene name
An07g02180
Definition
dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_274064 (An07g02180)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_274064 (An07g02180)
   00020 Citrate cycle (TCA cycle)
    ANI_1_274064 (An07g02180)
   00620 Pyruvate metabolism
    ANI_1_274064 (An07g02180)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ANI_1_274064 (An07g02180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 481 aa AA seqDB search
MVASAVRMRAPSAMFLSKGALSLKRPQTVHRFKDIAQSQLPSLSALSRFYASKSFPPHTV
ISMPALSPTMSAGNIGAWQKKAGDALQPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETG
EKDVSVGSPIAVLVEEGVDVAAFEAFTLADAGGEKAAPAAEESKQESKAADAAPASEPAP
AAVEPETSGEKLQPSLDREPSISPAAKALALEKGVPIKALKGTGRGGQITKEDVEKYKPS
ASAGPTYEDVPLTSMRKTIASRLQQSVRENPHFYVSTTLSVSKLLKLRQALNASSEGKYK
LSVNDFLVKACAAALMKVPTVNSSWHEENGQTVIRQHKTVDVSVAVSTPNGLITPIVKSV
EGRGLSSISNQIKDLGKRARDNKLKPEEYQGGTFTISNMGMNPAVERFAAVINPPQAGIL
AVGTIRKVAVPVETEEGTSVEWDDQIIVTGSFDHRVVDGVVGAEWIKELKKVVENPLELL
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggttgcttctgctgtccggatgcgcgctcccagcgccatgttcctctccaaaggcgct
ctctccctgaagcggccgcaaactgttcacagattcaaggatatcgctcaatctcaattg
ccttccctttccgccctctcccgtttttatgcctccaagtccttccctccccacactgtc
atcagcatgccggccttgtcgccgaccatgtccgccggaaacattggagcttggcagaag
aaggccggtgatgccctgcagcccggtgatgtcctggtagagattgagaccgataaggcc
cagatggactttgagttccaggaagagggtgttctggccaaggttctcaaggagactggc
gagaaggatgtttctgtcggctcccctatcgctgtcttggttgaggaaggtgtcgatgtt
gctgctttcgaggctttcaccctggcggatgctggtggtgagaaggctgctcctgccgct
gaggagagcaagcaggagtccaaggccgctgatgctgcccctgcttctgagcctgcccct
gctgccgttgagcctgagacttcgggcgagaaactccagcccagtctggaccgtgagcct
tccatcagccctgctgccaaggccctggctctggagaagggtgtgcccatcaaggctctc
aagggtaccggacgtggcggtcaaatcaccaaggaggacgttgagaagtacaagcccagt
gcttctgccggtcctacctacgaggacgttcccttgacctccatgcgcaagaccattgct
agccgcctccagcagtccgtgcgcgagaaccctcacttctacgtctccacgaccctgtct
gtgagcaagctcctcaagcttcgccaggccctcaatgcttcctccgagggcaagtacaag
ctttccgtcaacgacttcctcgtcaaggcctgcgccgccgccctcatgaaggtccccacc
gtcaactccagctggcatgaggagaacggccagaccgtcatccgtcagcacaagaccgtc
gacgtcagtgttgccgtctctacccccaacggtctcatcacccccatcgtcaagagcgtt
gagggccgtggtctgtccagcatctccaaccagatcaaggacttgggcaagcgcgcccgc
gacaacaagctcaagcccgaggagtaccagggtggcactttcaccatcagcaacatgggt
atgaaccctgctgttgagcgcttcgccgccgtcatcaacccccctcaggccggtatcctg
gccgttggtaccatccgcaaggttgccgttcccgtcgagactgaggagggcacctccgtt
gagtgggatgaccagatcatcgtcactggcagcttcgaccaccgtgtcgtcgatggtgtt
gtcggtgccgagtggatcaaggagctgaagaaggttgttgagaaccccctcgagcttctt
ttgtaa

DBGET integrated database retrieval system