KEGG   Aspergillus niger: ANI_1_288024Help
Entry
ANI_1_288024      CDS       T01030                                 

Gene name
An02g02170
Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ang  Aspergillus niger
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANI_1_288024 (An02g02170)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_288024 (An02g02170)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANI_1_288024 (An02g02170)
Enzymes [BR:ang01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANI_1_288024 (An02g02170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MDGIKNAFARAKQEKRAALVAYFTAGYPTVEETVDVLMGLENGGADIIEMGVPFTDPIAD
GPTIQKANTQALANGVTIPMVLDQVRAARSRGLRAPVLLMGYYNPLMQYGEELMLQHCKE
AGVNGFIMVDLPPEEAVRFRDLCASAGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGKLSSNLPELLSRVHTWSGNVPTALGFGVSTREHFLSVQNISEGVVIGSQIITV
LGDAPAGQAAKHAQDYLTSVTGRRLERDAQGKVTGSVNVLDPVLKEAPPALSQPTDVITN
DDTPAGPGLVDQIEALNGSGDPALIPSRFGEFGGQYVPESLMDCLAELERGFDEARNDPK
FWEEYRSYYPYMGRPSSLHLADRLTEHVGGANIWLKREDLNHTGSHKINNALGQILLARR
LGKKRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMRLLGASVVAVD
AGSRTLRDAVNEALRAWVVHLDTTHYIIGSAIGPHPFPTIVRTFQSVIGDETKEQMKTLI
GKLPDAVVACVGGGSNAVGMFYPFSNDPSVKLLGVEAGGDGVDTDRHSATLSGGSKGVFH
GVRTYVLQDKHGQISETHSISAGLDYPGVGPELSNWKDSDRAKFIAATDAEALTGFRALA
QTEGIIPALESSHAVFGAMKLAKSMKKGDNIVLNLSGRGDKDVQSVADELPRLGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggacggaatcaagaatgcattcgccagagctaagcaggagaagcgtgctgctctggtc
gcctacttcactgcaggatatcctactgtcgaggagaccgtagatgttctgatgggcctg
gaaaatggtggtgctgacattatcgaaatgggtgtccctttcaccgaccccatcgcagac
ggaccgactattcagaaggccaacactcaggctttggccaatggtgtcacgatccccatg
gtcctggaccaggtccgcgccgccagaagccgcggtctgagggcacccgttcttttgatg
ggctactacaaccctctgatgcagtatggtgaggagctcatgctccaacactgcaaggaa
gccggcgtcaatggattcatcatggtcgatctgcccccggaggaggccgttcgcttcaga
gatctttgcgccagcgctggtctctcttacgttcccctcattgctcccgccacctccgag
tcccgcatgaagcttctttgcaagattgccgattccttcatctacgtcgtctccagaatg
ggtgtcaccggtgccaccggaaagctcagctcgaacctgcccgaactcctgtctcgcgtt
cacacttggtccggaaacgtgcctacggcactaggattcggtgttagcacccgcgagcac
ttcctgtccgtccagaacatctccgagggtgttgttattggtagccagatcatcaccgtt
ttgggtgacgcccctgccggccaggcggctaagcatgcccaggactaccttaccagcgtg
accggtcgtcgccttgagagagacgctcagggcaaggtgactggctccgtcaacgtgctt
gaccccgtcctgaaggaggctcctcctgccctctctcagcccactgatgtcattaccaac
gacgacaccccggctggcccgggcctggtcgaccagattgaagctctgaacggctctggt
gaccctgctctcattccctcccgtttcggcgagttcggtggccagtacgtgcccgaatcc
ctgatggactgcttggccgagctcgagcgtggctttgatgaggcgcgcaacgaccctaag
ttctgggaggaataccgctcctactacccctacatgggccgccccagcagccttcatctt
gctgaccgcttgacggagcatgtcggcggtgccaacatctggttgaagcgtgaggatctt
aaccacactggaagtcacaagatcaacaacgctctcggtcagatcctgcttgcccgccgt
ctgggcaagaagagaatcattgccgagactggtgctggccagcacggtgtcgccacggct
accgtttgcgccaagttcggcatggagtgtgtcgtgtacatgggtgccgaggatgtccgt
cgtcaggctctcaatgtcttccgtatgagacttcttggtgcttccgtcgttgccgtcgac
gccggcagccgcaccctccgtgatgctgtcaacgaggccctccgcgcctgggttgtccac
ctcgacactacccactacatcatcggttccgccatcgggcctcaccccttcccgaccatc
gtgcgtaccttccagtctgtcattggtgatgaaaccaaggaacagatgaagacccttatc
ggcaagctgcccgatgctgtcgtcgcctgcgttggtggtggcagtaacgccgtgggtatg
ttctaccccttctcgaacgaccccagcgtcaagctcctgggtgttgaagccggtggtgac
ggtgtcgacaccgaccgccactccgccaccctctccggcggcagcaagggtgtcttccac
ggtgtccgcacctacgtcctccaggacaagcacggccagatctccgaaacccactccatc
tccgccggtctcgactaccccggtgtcggccccgagctctccaactggaaggacagcgac
cgcgccaagttcattgccgccaccgacgccgaagccctcaccggcttccgtgctctcgct
cagaccgagggtatcatccccgctctggagtcctcccacgccgtcttcggtgccatgaag
ctcgccaagtccatgaagaagggtgacaacatcgtcctcaacctcagtggaagaggtgac
aaggatgtccagagtgtggctgatgagctgcctcgtctgggtcctaagatcggctgggac
ttgcgcttctaa

DBGET integrated database retrieval system