KEGG   Aspergillus niger: ANI_1_288024Help
Entry
ANI_1_288024      CDS       T01030                                 

Gene name
An02g02170
Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ang  Aspergillus niger
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANI_1_288024 (An02g02170)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_288024 (An02g02170)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ANI_1_288024 (An02g02170)
Enzymes [BR:ang01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ANI_1_288024 (An02g02170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MDGIKNAFARAKQEKRAALVAYFTAGYPTVEETVDVLMGLENGGADIIEMGVPFTDPIAD
GPTIQKANTQALANGVTIPMVLDQVRAARSRGLRAPVLLMGYYNPLMQYGEELMLQHCKE
AGVNGFIMVDLPPEEAVRFRDLCASAGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGKLSSNLPELLSRVHTWSGNVPTALGFGVSTREHFLSVQNISEGVVIGSQIITV
LGDAPAGQAAKHAQDYLTSVTGRRLERDAQGKVTGSVNVLDPVLKEAPPALSQPTDVITN
DDTPAGPGLVDQIEALNGSGDPALIPSRFGEFGGQYVPESLMDCLAELERGFDEARNDPK
FWEEYRSYYPYMGRPSSLHLADRLTEHVGGANIWLKREDLNHTGSHKINNALGQILLARR
LGKKRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMRLLGASVVAVD
AGSRTLRDAVNEALRAWVVHLDTTHYIIGSAIGPHPFPTIVRTFQSVIGDETKEQMKTLI
GKLPDAVVACVGGGSNAVGMFYPFSNDPSVKLLGVEAGGDGVDTDRHSATLSGGSKGVFH
GVRTYVLQDKHGQISETHSISAGLDYPGVGPELSNWKDSDRAKFIAATDAEALTGFRALA
QTEGIIPALESSHAVFGAMKLAKSMKKGDNIVLNLSGRGDKDVQSVADELPRLGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggacggaatcaagaatgcattcgccagagctaagcaggagaagcgtgctgctctggtc
gcctacttcactgcaggatatcctactgtcgaggagaccgtagatgttctgatgggcctg
gaaaatggtggtgctgacattatcgaaatgggtgtccctttcaccgaccccatcgcagac
ggaccgactattcagaaggccaacactcaggctttggccaatggtgtcacgatccccatg
gtcctggaccaggtccgcgccgccagaagccgcggtctgagggcacccgttcttttgatg
ggctactacaaccctctgatgcagtatggtgaggagctcatgctccaacactgcaaggaa
gccggcgtcaatggattcatcatggtcgatctgcccccggaggaggccgttcgcttcaga
gatctttgcgccagcgctggtctctcttacgttcccctcattgctcccgccacctccgag
tcccgcatgaagcttctttgcaagattgccgattccttcatctacgtcgtctccagaatg
ggtgtcaccggtgccaccggaaagctcagctcgaacctgcccgaactcctgtctcgcgtt
cacacttggtccggaaacgtgcctacggcactaggattcggtgttagcacccgcgagcac
ttcctgtccgtccagaacatctccgagggtgttgttattggtagccagatcatcaccgtt
ttgggtgacgcccctgccggccaggcggctaagcatgcccaggactaccttaccagcgtg
accggtcgtcgccttgagagagacgctcagggcaaggtgactggctccgtcaacgtgctt
gaccccgtcctgaaggaggctcctcctgccctctctcagcccactgatgtcattaccaac
gacgacaccccggctggcccgggcctggtcgaccagattgaagctctgaacggctctggt
gaccctgctctcattccctcccgtttcggcgagttcggtggccagtacgtgcccgaatcc
ctgatggactgcttggccgagctcgagcgtggctttgatgaggcgcgcaacgaccctaag
ttctgggaggaataccgctcctactacccctacatgggccgccccagcagccttcatctt
gctgaccgcttgacggagcatgtcggcggtgccaacatctggttgaagcgtgaggatctt
aaccacactggaagtcacaagatcaacaacgctctcggtcagatcctgcttgcccgccgt
ctgggcaagaagagaatcattgccgagactggtgctggccagcacggtgtcgccacggct
accgtttgcgccaagttcggcatggagtgtgtcgtgtacatgggtgccgaggatgtccgt
cgtcaggctctcaatgtcttccgtatgagacttcttggtgcttccgtcgttgccgtcgac
gccggcagccgcaccctccgtgatgctgtcaacgaggccctccgcgcctgggttgtccac
ctcgacactacccactacatcatcggttccgccatcgggcctcaccccttcccgaccatc
gtgcgtaccttccagtctgtcattggtgatgaaaccaaggaacagatgaagacccttatc
ggcaagctgcccgatgctgtcgtcgcctgcgttggtggtggcagtaacgccgtgggtatg
ttctaccccttctcgaacgaccccagcgtcaagctcctgggtgttgaagccggtggtgac
ggtgtcgacaccgaccgccactccgccaccctctccggcggcagcaagggtgtcttccac
ggtgtccgcacctacgtcctccaggacaagcacggccagatctccgaaacccactccatc
tccgccggtctcgactaccccggtgtcggccccgagctctccaactggaaggacagcgac
cgcgccaagttcattgccgccaccgacgccgaagccctcaccggcttccgtgctctcgct
cagaccgagggtatcatccccgctctggagtcctcccacgccgtcttcggtgccatgaag
ctcgccaagtccatgaagaagggtgacaacatcgtcctcaacctcagtggaagaggtgac
aaggatgtccagagtgtggctgatgagctgcctcgtctgggtcctaagatcggctgggac
ttgcgcttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system