KEGG   Aspergillus niger: ANI_1_2966014Help
Entry
ANI_1_2966014     CDS       T01030                                 

Gene name
An01g10170
Definition
dual specificity protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ANI_1_2966014 (An01g10170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 679 aa AA seqDB search
MSTPSTATATHPHQQHYGYPHHQPYQPNASYPTTSAAGTSRLIPSSYPYPVSAPTPATLP
FVQSPKLMPTAPTPTTTTSTTTTNNTTTATTTMPPAHNAVGAGTTAQGSRRRKPNWGEFY
KNGIPKEVIVIDDTPPPEQSKASSRSLATASTVTAANGNGPQPAGKKRRTGIESAYDVTY
YDRPSYSINPQHYGEESSAASLSTDRTTSLHTTAPTSLSQGSSGASNGIIYEDANVGQKR
KRVTTRKSARDEQKRRELENAGDAFLSYVPPPKPPIKAKDVPVPVVRDYANRGEKYDDDD
GHYIVNPNTPLTERYSIIKLLGQGTFGKVVEAFDKQRKTRCAVKIIRSIQKYRDASRIEL
RVLSTLASNDKQNRNKCIHLRDCFDYRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQN
FARQLFTSVAFLHDLNLIHTDLKPENILLVSNAYQTFTYNRTIPSSSHAISRSARQRRVL
LDSEIRLIDFGSATFDDEYHSSVVSTRHYRAPEIILNLGWSFPCDIWSIGCILVEFFTGD
ALFQTHDNLEHLAMMEAVIGDRIDTRLVRQVMQGGRSAGQNQAAKYFNRNRLEYPNDQTT
RASRKYVKAMKQLPDFIPTNTKFHKLFLDLLQRIFVYDPKNRITAKEALKHQWFKESLVD
DGTEALRIGEQLQRTTQRR
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccttccacggctaccgcgacgcatccgcatcagcaacactacggatacccc
catcatcaaccctaccaaccgaacgcatcgtatcccaccacgtccgctgcaggcacttct
cgcctcatcccctcttcatatccctatcccgtctccgccccgacgcctgccacccttccc
ttcgtgcaatctccgaagcttatgccaaccgcacccaccccaacgactaccacatccacc
accaccaccaacaacacaaccactgccaccacaacaatgcctccagcccacaacgctgtg
ggcgctggcacaacagcgcaaggcagccggagaaggaagcccaactggggcgagttctac
aaaaatgggatcccgaaggaggtgattgtcattgatgacacgccccctccggaacagtcc
aaagcctcctcgcgcagtctcgcgacagcgtccaccgtcacggcagccaacggcaacggt
cctcagcccgctgggaagaaacggcgcaccggcatcgagtcagcctacgacgttacgtat
tatgatcggccgtcgtactcgatcaatccacaacactatggcgaggagtcatcggctgcc
tccctgtcgaccgatcggacaacctctctgcacaccacggctcccacatctctctcccag
gggagttcgggggccagtaatgggatcatctacgaagacgccaatgttggccagaaacgc
aagcgcgtaaccacccgcaagtccgctcgcgatgagcaaaagcggcgggagttggagaat
gcaggtgatgcgttcttgagctatgtcccgccgccgaagccgcccatcaaggcaaaggac
gttcctgtgcctgtggtccgcgattatgcaaatcgaggcgaaaagtatgatgacgacgat
ggccactatattgtcaacccgaatactcccttgactgagcggtactcgatcatcaaactc
ttggggcaaggtaccttcggaaaggtggttgaagcgtttgacaagcagcgtaagacccgc
tgcgccgtcaagatcatccgctcgatccaaaagtaccgggatgcttcgcggattgaactt
cgggtactgtccacactggcctcaaacgacaagcagaaccgcaacaagtgcatccaccta
cgagactgttttgactaccgcaatcatatctgcatcgtaacggacctgctggggcaaagt
gtcttcgattttctgaagggaaacggctttgtgccgttccccagcagtcaaattcaaaac
tttgcccggcagctgttcaccagcgtagccttccttcacgacctcaatctcatccacacc
gaccttaagcccgaaaacattctcctcgtcagcaacgcttaccaaaccttcacctataat
cgcaccatcccatcctcttcgcatgccatctcccggagtgcacgtcaaagacgtgtgctg
ttggacagtgagatccggctgattgactttgggtcagccacgttcgatgatgagtatcac
tcgtctgtggtgtccactcgacactatcgggcccctgagatcatcttgaatctgggctgg
agtttcccctgcgatatctggagtatcggttgcatcctcgtggagttcttcactggggac
gcccttttccagacgcatgacaacctagagcatcttgccatgatggaagctgttatcggc
gatcgcatcgacactagactagtgaggcaggtgatgcagggcggtcgcagcgcaggccag
aaccaggccgccaaatatttcaacaggaaccggcttgaatacccgaacgatcagaccact
cgtgcctcacgaaaatatgtcaaggcaatgaagcagcttccagacttcatcccgaccaac
accaagttccataagctattccttgatctccttcagcggatattcgtgtatgacccgaag
aaccgtatcaccgccaaggaagctttgaagcaccagtggttcaaggagtccttagtggat
gacggcaccgaagccctacggattggggagcagctgcaacgcaccactcagcggcgttga

DBGET integrated database retrieval system