KEGG   Aspergillus niger: ANI_1_298184Help
Entry
ANI_1_298184      CDS       T01030                                 

Gene name
An04g01340
Definition
asparagine synthetase [glutamine-hydrolyzing] 2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ang  Aspergillus niger
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ANI_1_298184 (An04g01340)
Enzymes [BR:ang01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ANI_1_298184 (An04g01340)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C44
   ANI_1_298184 (An04g01340)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MCGIFACHHHPDVQKFKLTALRMAKALRHRGPDWSGSWMSDKTILAHERLCIVGVDSGAQ
PLVNDDGSLALAVNGEIYNHRILRKGLKTKYQFKTHSDCEVVIPLYMEHGLDAPKHLDGM
FSWVLYDKNQDKVVAARDPIGITSFYIGWSSETPGAVYFASELKSLHPVCDKIEAFPPGH
IFDSKTGSFTRYFQPTWWDPANVPSAPVDYKVIRASLEKSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRETLRMQEAARAAQAQGAELNELVGIDDSNDLSTVTTFQQLHSFSIGLPGA
PDTEAALKVAKFLGTKHHAFTFTVEDGLNALSDVIYHLETYDVTTIRASTPMYLLSRKIK
AMGVKMVLSGEGSDEIFGGYLYFHAAPDREEFHKETVRRVKNLHLADCLRANKSTSAWGL
EARVPFLDKEFLETCMGVDPAEKMITKERIEKYILRKAFDTTDEPDVKPYLPDNILWRQK
EQFSDGVGYSWIDALKDQAEAHVTDEMMKNPKPEWGSDIPDTKEAYWYRTMFDELFPASC
AGTVERWVPTWSKQTDPSGRAIATHNAKYENAV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcttcgcgtgtcatcatcaccccgatgtgcaaaaattcaagcttacggcc
ctgcgcatggccaaggctttgcgccaccgtggtcccgattggagtggaagctggatgtct
gacaagaccatcctcgcgcacgagcgactgtgtatcgtcggtgttgactccggtgcccag
ccccttgtcaacgacgatggctcccttgccttggccgtcaacggcgagatctataaccac
cgtatcctccggaagggactgaagaccaagtatcagttcaagacgcattccgactgtgag
gtcgtcattcccttgtacatggaacacggactcgatgctcccaagcacctggatggcatg
ttctcctgggttctctatgacaagaaccaggacaaggttgtcgccgctcgtgatcccatc
ggtatcaccagcttctacattggctggtcctctgagacccccggagccgtctacttcgct
tccgagctgaagtctctccacccggtttgcgacaagatcgaggctttccctcccggccac
atcttcgactccaagaccggctctttcacccgctacttccagcctacctggtgggatccc
gccaacgttccctccgcccctgtcgactacaaggtcatccgcgcttccctcgagaagtct
gttcgcaagcgtctgatggctgaggtcccctatggtgtcttgctttccggtggtctcgat
tccagcttggtcgcctccatcgctcagcgggaaactctgcgtatgcaggaggccgccagg
gctgctcaggcccagggtgctgagctgaacgagttggtcggcattgacgactccaacgat
ctgtccaccgtcaccaccttccagcagctgcactccttctcgattggtctgcctggtgcc
cccgataccgaggcggccctcaaggtggccaagttcctcggaaccaagcaccatgctttc
actttcaccgttgaggatggtctcaacgccctctccgacgtcatctaccacctggagact
tacgatgtcaccaccatccgtgcttccacccccatgtacctgctcagccgcaagatcaag
gctatgggtgtcaagatggttctcagtggtgagggtagtgatgagatcttcggtggatac
ctttacttccacgctgctcccgaccgtgaggagttccacaaggagactgtccgccgtgtc
aagaacctgcacttggcggattgcctgagagccaacaagtccacctctgcctggggtctg
gaagcccgtgttcctttcctggacaaggagttccttgagacttgcatgggtgttgaccct
gccgagaagatgatcaccaaggagcgtattgagaagtacatcctgcgcaaggcgttcgac
accaccgacgagcccgacgtcaagccctacctgcccgacaacattctctggcgccagaag
gagcagttcagtgacggtgtcggctacagctggatcgatgccctcaaggaccaggctgag
gcgcacgtcaccgacgagatgatgaagaaccccaagcccgagtggggtagcgatatcccc
gacaccaaggaagcctactggtaccgcacgatgttcgacgaacttttcccagcttcttgt
gccggcactgttgagcgttgggtaccgacctggtcgaagcagaccgacccgagtggcaga
gctattgcgactcacaacgccaagtatgaaaacgccgtttaa

DBGET integrated database retrieval system