KEGG   Aspergillus niger: ANI_1_3070024Help
Entry
ANI_1_3070024     CDS       T01030                                 

Gene name
An02g11590
Definition
checkpoint protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ang  Aspergillus niger
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ang00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ANI_1_3070024 (An02g11590)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ANI_1_3070024 (An02g11590)
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: Other group
  TTK family
   ANI_1_3070024 (An02g11590)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 848 aa AA seqDB search
MSVDFLVQQSRLLFNTNIDPWLVDLAIVMARKPFGKGNPHLPAYFDNSRTREMSRAALSR
SGSRRTSPEFQNSSAFRTHSSVARQYSPGDSSDDEVPEPKFSASVKALLDEDGLDVSPRL
RGERMGSSASSSQERRSRATPPQSNSTGSPAPRVVRIAPSLSGSGGRSRREGSLLSNSES
ADQDARTNSNDFITPAPRPRSVRINASRSHTRSPASVSPSQRRSAERSYVDEHGSAERSE
DERKYRYEDDYAPRTGPSSVLRTRNPEDIGMASSLRVKRVGRLTGTFLNGPARRGVLRRQ
SEENNEDQELDPNIDSADYHYKNTAKSSSPKVSWADPSPPLRTDEHRSYDRADGPFSRSS
SPKSYGSHSKSTPGSSSEMSSKPSSSQEQPVFKVPLPPTLPSSRDQENEPPPTFKRTKPQ
GFNLLDKPEKLAVVYGDEKKEHGETPAGNGNSPRKILATRSNNTPHRPAPPPPKMSVLET
ATATGGAATASQSRKKRSQVSVNHKPFTRLDCIGRGGSSRVYRVMAENYKIFALKRVNLE
DVDPTTLAGYKGEIDLLKKLENLDRVVRLFDWELNSDKHTLSVLMEIGESDLEKILTYRL
NAEDARFDINFTRYYWKEMLECVQAVHDHNIVHSDLKPANFLLVQGRLKLIDFGIANAIQ
DNTVNVHREQQVGTPNYMSPEALVDSNASLGLPASVGKMMKLGKPSDVWSLGCILYKMVY
GQPPFAKIAKYYERILAIPNPHVKIDFPAFGVGGVPVPPGLVRTLKRCLQRDQTLRPTVE
ELLGQRDPFLYPDAQLEGAVPVTQDMLNRILVNVVNHCRVRGIPKDEELAAWPAGFFAKI
KAALEEGS
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttgactttctcgtgcagcaatctagactgctcttcaataccaatattgatccc
tggctagtcgacctggcaatcgtaatggcaagaaagccttttggaaagggcaatccacac
ctaccggcttacttcgacaattctcgtacccgtgagatgtcccgcgccgcgctctcccgc
tccgggtccaggcggacctccccagagttccaaaactcatccgcctttcgaacccattcc
tccgtggccagacaatactcgccgggagatagctctgacgacgaagtccccgaaccgaaa
ttcagcgcgtccgtcaaggccctgcttgatgaagatggactagatgtgtccccacggctt
cgcggcgagcgcatgggatcatcggctagctccagccaggaaagacgatctcgagcaacg
cctcctcaaagcaattcgaccggaagccctgcgcctcgcgtggttcgcattgcaccatca
ttaagcggcagcggcggcagatcaagaagggagggatcactcctgtccaacagcgaaagt
gccgaccaggacgcaagaaccaattcgaatgatttcattacgcccgccccaaggccacgc
agtgtgcggatcaatgcatcgcgtagccatacacgctcacccgcatccgtatccccctct
cagagacgctctgctgaaaggagctatgtcgacgagcacggaagtgcggaacgttcagaa
gatgaaaggaagtataggtatgaggatgactacgctcctcgcaccggtccttcatcggta
ttacgaacgcgaaatccggaggatatcggcatggcgagctcattgcgcgtcaagagggtc
ggacgactcactggaacgttcttgaacggtcccgcaagacgtggtgtattacgacgacag
agtgaagagaataatgaagaccaagagctcgacccgaatatcgatagcgccgactaccac
tataagaatacagcgaaatcttcgtcacccaaagtatcatgggccgatccaagcccacca
ctcagaaccgacgagcaccgatcctatgatcgtgcagatggacccttttctagatcatcc
tctccgaaatcctatggatcgcactcgaaatcaacacctgggtcttcttcagaaatgtcc
tccaaaccctcaagttcgcaggaacagcctgtgttcaaagtccctcttccgcctacattg
ccttcgtctagagaccaggagaatgagcctccaccgacgttcaagcgcaccaagcctcag
ggtttcaacttgctggacaagcctgagaagcttgctgtggtgtatggggatgagaagaaa
gagcatggggagacacctgcagggaacgggaactcccctagaaagatacttgcaacaaga
agtaataacacccctcacaggccggcccctcctcctcctaagatgtccgttcttgagacc
gccaccgcgacaggaggagctgctacggcatcacagtcacggaaaaagcgcagtcaagtt
tcggtcaaccacaagcccttcacccggctggactgcatcggtcgtggtgggagttcgaga
gtctaccgcgtcatggctgaaaactataagatatttgccctgaagagggtaaatctggag
gacgtcgatccaacaaccctagctggatacaagggtgaaattgacttgctgaagaaattg
gagaaccttgatcgtgtcgtccgcttattcgattgggagctgaactcggacaaacatact
ctgagtgtcttaatggaaattggagagtcagatctagagaagatccttacctaccgactg
aacgctgaagacgcgagattcgacatcaactttacccgatactactggaaggagatgctc
gagtgtgtccaagctgtacacgatcacaacattgtccactctgatctgaaaccggcgaac
ttcctcctggttcagggccgattgaaacttatcgatttcggcattgcgaacgccatccaa
gataacactgtaaatgtgcaccgtgaacagcaggtggggactccgaattacatgtccccc
gaggccttagtcgactccaacgcttctctcggcctgccagcaagtgtcggaaagatgatg
aagctaggcaagccaagtgacgtatggagtttgggatgcattctctataagatggtgtac
ggccagcctccgtttgccaaaatcgccaaatactacgaacgcatcctagccatccctaat
ccccacgtgaagattgacttcccagcattcggcgtagggggcgtccccgtacctcctggt
ctagtccgaacgctgaagcgctgtctccagcgcgatcaaactttacgtccaaccgtggaa
gagcttctcggccagcgcgatccattcctctacccagacgcgcagctcgaaggtgctgtc
ccagtcacacaggacatgctgaaccgaatcctagtgaacgtggtcaaccactgccgtgtc
cgtggtatccccaaggacgaagaactagccgcttggcccgccggattcttcgctaaaatc
aaagctgcactagaagaaggcagctag

DBGET integrated database retrieval system