KEGG   Aspergillus niger: ANI_1_3102014Help
Entry
ANI_1_3102014     CDS       T01030                                 

Gene name
An01g11670
Definition
endo-beta-1,4-glucanase A
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANI_1_3102014 (An01g11670)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ANI_1_3102014 (An01g11670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 410 aa AA seqDB search
MKTLSLAAVLLVQAWTANSSPRAKRSSGFQWFGSNESGAEFGSGNIPGTLGTDYIWPDAT
AIATLHSAGMNIFRVPFLMERLVPDELTGAADATYMADLKATVQTITDLGAYAVVDPHNF
GRYYGNIITSTSDFAAFWTTVASEFTDNDLVIFDTNNEFHDEDQTLVLDLNQAAITAIRA
TAATTQYIFVEGNSYTGAWTWTTTNTNLVNLTDPNDHLIYEMHQYLDSDGSGTSSTCVSS
TIGAERIADATTWLKENGKQAVLGEFAGGANSVCEEAVTGMLDAMVDASDVWLGGMWWSA
GPWWGDYIFSLEPDDGIAYEYYLGVLEGYTPGSSSGSSGGSTTSAVASASSTSSAGSTTS
KVTTTTAATATSTAVAAHYAQCGGEGWTGATTCADGYTCTVENEWYSQCL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaagactctctcccttgccgctgtcttgctcgtccaagcctggactgcgaacagcagt
ccgagggctaagcggtcgtctggtttccaatggttcggtagcaacgaatccggcgccgaa
tttggctccgggaatatccccggcactttgggcacggattacatctggcctgatgcgacg
gctatcgcgacgctgcatagtgctgggatgaatatcttccgcgtgccgttcctgatggag
cggttggtgccggatgagttgactggtgcggcggatgcgacgtatatggctgatctgaag
gctacggtgcaaaccatcacagaccttggtgcttatgcggtggtggatccgcataatttt
gggagatactacggtaacatcatcacctcaaccagcgactttgcagccttctggacaaca
gtcgccagcgagttcaccgacaatgaccttgtcatcttcgataccaacaacgaattccac
gacgaagaccaaaccctcgtgctcgatctcaatcaagccgccatcaccgccatccgcgcc
accgctgccacaacgcaatatatcttcgtcgaaggcaattcctacaccggcgcctggacc
tggaccaccaccaacacgaacctcgtcaacctgaccgaccccaacgaccatctcatctac
gaaatgcaccagtacctggacagcgatggctccgggacgagttcgacgtgcgtcagctcg
acaattggtgcggagcgcattgctgatgccacaacctggttgaaagagaatggcaagcag
gcggtgctgggggagttcgcgggcggcgcgaatagtgtatgtgaggaggcggttacaggc
atgttggatgcgatggtggatgctagtgatgtttggctggggggcatgtggtggtctgct
gggccttggtggggggattatatcttctcgttggagcccgatgatggaattgcttatgag
tattatttgggggtgttggaggggtatacgcctggttcatcttcgggatcatctggaggg
agtacaacaagtgccgtggcgagtgctagtagtacgtcgtctgctgggagtactacgagc
aaagtgactactactactgctgcgactgctacatcgacggctgtagctgcgcactatgct
cagtgtggtggggagggctggactggggcgacgacttgtgcggatggatatacctgcaca
gtagaaaatgagtggtattcgcagtgtttgtag

DBGET integrated database retrieval system