KEGG   Aspergillus niger: ANI_1_3150024Help
Entry
ANI_1_3150024     CDS       T01030                                 

Gene name
An02g12490
Definition
endosome-associated ubiquitin isopeptidase (AmsH)
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
ang  Aspergillus niger
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ANI_1_3150024 (An02g12490)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ANI_1_3150024 (An02g12490)
Peptidases [BR:ang01002]
 Metallo Peptidases
  Family M67
   ANI_1_3150024 (An02g12490)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MAAHLPPATGAGSPQSVESITRMAQDYEYNPSIPLRYWLRTASTLMREARIYEREKHEEQ
AYLLLFRHAQLVLVNLAEHPEARDEKNRKALVEAEKEVKRNLKLMRERQARAPAAANNTP
TSTQRPPQDPALAGVVEPLEAGENKDLAVQLARTELSRRATVRKAIRQAGITPEEEQTRR
AAGVWGDWEHALRKDGTEDDDLSRRIQNVRIQMDDPRADHRPQVATKPMVRPSAATSSTG
TYKYPSVPRQKPLEVPSAAKVEPEKRIVLPPKAPALPPKETSYVHELAGLEGPSPPPRPD
KVSPAAIPAEPPVLPGKVPATDGSAASPNLDPSSYTFKPSAYLENGTPLRTLFLPPDLRK
HFISLVSPNTQRNLETCGILCGTLVSNALFVSRLLIPEQTATSDTCETVNESAIFDYCDS
EDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPSKTPDWGVFRLTDPPG
LKTVLNCTQSGLFHPHGEANIYTDALRPGHVFEAKGLEFETVDLRPKGSQF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccatctacctccggctaccggtgcggggtccccgcagagtgtggaatcaatc
actcgcatggctcaggattatgagtacaacccgtctatacctctacgctactggctgcga
acagcgtctactctcatgagagaggctcggatttacgaacgcgaaaagcacgaagaacaa
gcctaccttttattgtttcgccatgctcagttggtacttgtcaatttggcggagcatcca
gaggccagagatgaaaagaatcggaaagctttggtggaagccgaaaaggaggtcaaacga
aacctgaagttgatgcgtgaacggcaagctcgcgcaccagcagcggcgaataacactccc
acttcaacccagagaccccctcaagatcccgccctcgcaggggtcgtggaacctctggaa
gcaggagagaacaaagacctggcggtgcagctggctcggacggagcttagccgacgagca
actgtccgaaaggctatccgacaagcaggcataacacctgaagaggagcagactcgtcgg
gctgctggcgtgtggggagactgggagcatgccctgcgcaaagatggaaccgaggacgat
gacttgagccggcgcatacagaacgtgagaatccagatggacgatccgcgggcggatcac
cgtccacaggttgccactaagcctatggtccggccatctgccgcaacctcttcaaccggc
acatacaagtatccgagcgtccctcgtcagaagccgctggaagttccgtcggccgcaaag
gtggagcctgagaagaggattgttcttccgcccaaagcgcccgcactgcctcctaaggaa
acttcgtatgtacatgaactggctggccttgaaggaccttcacctccacctcgtccagac
aaggtctcgcccgcagcgatcccggctgagcctcctgtgcttcctggaaaggttccagca
accgatgggtcagctgccagcccgaatttggacccgtccagctataccttcaagccctct
gcttatctagagaacggaacgcctctgcggacgttgttcctgccacctgatctacgcaag
cacttcatctcactggtatccccgaatacgcagcgcaatctagagacgtgcggcattttg
tgcggcacgctagtctccaacgccttgttcgtttcgaggctgctcatccctgaacagacg
gccacgtcggacacgtgcgagacggtgaacgagtctgcgatcttcgactactgcgattca
gaggacttgatggtgctcggctggatccacacgcacccgacacagacgtgctttatgagc
tcgcgcgacctccacacacattgcggataccaggtgatgctgccggagagcattgcgatt
gtgtgcgcgcccagcaagacgcccgactggggagtgttccggctgacggatcctccgggg
ctgaagacggtgctcaactgcacgcagtcgggactcttccatccccatggagaggcaaac
atttacacagatgcgctgcgcccgggacatgtatttgaggcaaaaggattggagttcgag
acggtggatctgcgccccaaggggtctcaattctga

DBGET integrated database retrieval system