KEGG   Aspergillus niger: ANI_1_3150024Help
Entry
ANI_1_3150024     CDS       T01030                                 

Gene name
An02g12490
Definition
endosome-associated ubiquitin isopeptidase (AmsH)
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ang04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 531 aa AA seqDB search
MAAHLPPATGAGSPQSVESITRMAQDYEYNPSIPLRYWLRTASTLMREARIYEREKHEEQ
AYLLLFRHAQLVLVNLAEHPEARDEKNRKALVEAEKEVKRNLKLMRERQARAPAAANNTP
TSTQRPPQDPALAGVVEPLEAGENKDLAVQLARTELSRRATVRKAIRQAGITPEEEQTRR
AAGVWGDWEHALRKDGTEDDDLSRRIQNVRIQMDDPRADHRPQVATKPMVRPSAATSSTG
TYKYPSVPRQKPLEVPSAAKVEPEKRIVLPPKAPALPPKETSYVHELAGLEGPSPPPRPD
KVSPAAIPAEPPVLPGKVPATDGSAASPNLDPSSYTFKPSAYLENGTPLRTLFLPPDLRK
HFISLVSPNTQRNLETCGILCGTLVSNALFVSRLLIPEQTATSDTCETVNESAIFDYCDS
EDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPSKTPDWGVFRLTDPPG
LKTVLNCTQSGLFHPHGEANIYTDALRPGHVFEAKGLEFETVDLRPKGSQF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccatctacctccggctaccggtgcggggtccccgcagagtgtggaatcaatc
actcgcatggctcaggattatgagtacaacccgtctatacctctacgctactggctgcga
acagcgtctactctcatgagagaggctcggatttacgaacgcgaaaagcacgaagaacaa
gcctaccttttattgtttcgccatgctcagttggtacttgtcaatttggcggagcatcca
gaggccagagatgaaaagaatcggaaagctttggtggaagccgaaaaggaggtcaaacga
aacctgaagttgatgcgtgaacggcaagctcgcgcaccagcagcggcgaataacactccc
acttcaacccagagaccccctcaagatcccgccctcgcaggggtcgtggaacctctggaa
gcaggagagaacaaagacctggcggtgcagctggctcggacggagcttagccgacgagca
actgtccgaaaggctatccgacaagcaggcataacacctgaagaggagcagactcgtcgg
gctgctggcgtgtggggagactgggagcatgccctgcgcaaagatggaaccgaggacgat
gacttgagccggcgcatacagaacgtgagaatccagatggacgatccgcgggcggatcac
cgtccacaggttgccactaagcctatggtccggccatctgccgcaacctcttcaaccggc
acatacaagtatccgagcgtccctcgtcagaagccgctggaagttccgtcggccgcaaag
gtggagcctgagaagaggattgttcttccgcccaaagcgcccgcactgcctcctaaggaa
acttcgtatgtacatgaactggctggccttgaaggaccttcacctccacctcgtccagac
aaggtctcgcccgcagcgatcccggctgagcctcctgtgcttcctggaaaggttccagca
accgatgggtcagctgccagcccgaatttggacccgtccagctataccttcaagccctct
gcttatctagagaacggaacgcctctgcggacgttgttcctgccacctgatctacgcaag
cacttcatctcactggtatccccgaatacgcagcgcaatctagagacgtgcggcattttg
tgcggcacgctagtctccaacgccttgttcgtttcgaggctgctcatccctgaacagacg
gccacgtcggacacgtgcgagacggtgaacgagtctgcgatcttcgactactgcgattca
gaggacttgatggtgctcggctggatccacacgcacccgacacagacgtgctttatgagc
tcgcgcgacctccacacacattgcggataccaggtgatgctgccggagagcattgcgatt
gtgtgcgcgcccagcaagacgcccgactggggagtgttccggctgacggatcctccgggg
ctgaagacggtgctcaactgcacgcagtcgggactcttccatccccatggagaggcaaac
atttacacagatgcgctgcgcccgggacatgtatttgaggcaaaaggattggagttcgag
acggtggatctgcgccccaaggggtctcaattctga

DBGET integrated database retrieval system