KEGG   Aspergillus niger: ANI_1_320134Help
Entry
ANI_1_320134      CDS       T01030                                 

Gene name
An15g01860
Definition
malate synthase, glyoxysomal
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ang  Aspergillus niger
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_320134 (An15g01860)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANI_1_320134 (An15g01860)
   00630 Glyoxylate and dicarboxylate metabolism
    ANI_1_320134 (An15g01860)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ANI_1_320134 (An15g01860)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MVQVDTQLKDVVILGNVSSEARKILTKDACAFLAILHRTFNPTRKALLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNSDVWTYMADFE
DSSAPTWENMINGQVNLYDAIRRQVDFTQGGKEYKLRTDRVLPTLIARARGWHLDEKHFT
VDGTPISGSLFDFGLYFYHNAKELVARGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETISAAFEMDEIIYELREHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKNDPAANDKAMESVRADKLREV
RAGHDGTWVAHPALASIASEIFNTYMPTPNQLFVRREDVHITANDLLNTNVPGKITEDGI
RKNLNIGLSYMEGWLRGVGCIPINFLMEDAATAEVSRSQLWQWTHHGITTSDGKKVDKAY
ALRLLQEQADSLAAKGPQGNKFQLAARYFAGQVTGEDYADFLTSLLYNEISSAGKAEPAA
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaagtcgacacccaactcaaagacgtcgtcatcctcggcaatgtgagctcggag
gctcgcaagatcctcaccaaggacgcatgtgccttcctcgccatcctccaccgcaccttc
aaccctactcgcaaggccctcctccagcgccgcatcgaccgccaggccgagattgacaag
ggtcaccttcccgacttcctgcccgagacaaagcacattcgtgagaacgatgcctggaag
ggtgctcccccggctccgggactcgtcgaccgccgtgtggaaatcacgggtcccacagat
cgcaagatggtcgtcaacgcgttgaactccgatgtctggacatacatggctgatttcgag
gattccagcgcccccacctgggaaaacatgatcaacggccaagtcaacctctacgacgcc
atccgccgccaggtcgacttcacccaaggcggcaaggaatacaagctgcggacggaccgc
gtgctccccaccctcattgctcgcgctcgtggctggcacctcgacgagaagcacttcact
gtcgacggcacccccatctccggcagtctgtttgacttcggtctgtacttctaccacaat
gccaaggagctcgttgcgcgcggcttcggcccgtacttctacctccccaagatggagtcg
catctggaggcgcgtctatggaacgacgtcttcaacctggctcaggattacattggtatg
ccgcgcggaacgatccgtggtacggtgctgatcgagaccatctcggcggcgtttgagatg
gatgagatcatctacgagttgcgcgaacacagctccggattgaactgtggacgctgggat
tacatcttctccttcatcaagaagttccgcaagcaccccaactttgtgttgccggaccgc
tcggacgttactatgacggtgccgttcatggatgcgtatgtgaagttgttgattaagacg
tgtcaccgcagaggagtccatgctatgggaggcatggccgctcaaattcccatcaagaac
gaccccgccgccaacgacaaggccatggagagcgtgcgcgccgacaagctgcgtgaagtg
cgcgccggacacgacggcacctgggttgcgcaccctgcgctggcctccatcgcctcggag
atcttcaacacctacatgcccactcccaaccagctgttcgtccgccgcgaggacgttcac
atcaccgccaacgatctcctgaacaccaacgtccccggcaagatcaccgaggacggcatc
cgcaagaacctgaacatcggcctgtcctacatggagggatggctccgcggtgtgggctgc
attccgatcaacttcctgatggaggacgccgccaccgccgaagtctcccgcagtcagctc
tggcaatggacgcatcacggcatcaccacctcggacggcaagaaggtcgacaaggcgtac
gccctgcgtctcttgcaagagcaggcggacagtctcgcggccaagggtccccagggtaac
aagttccagcttgcagcgcggtattttgccggccaggtgacgggcgaggactatgccgat
ttcctgacgagtttgttgtataacgagatttcgtcggcgggcaaggcggagccggctgct
aagctgtaa

DBGET integrated database retrieval system