KEGG   Aspergillus niger: ANI_1_3440014Help
Entry
ANI_1_3440014     CDS       T01030                                 

Gene name
An01g15140
Definition
agmatinase 2
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ang  Aspergillus niger
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ANI_1_3440014 (An01g15140)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ANI_1_3440014 (An01g15140)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 409 aa AA seqDB search
MRYSLWWSIFGLIGGSSATQASPAHVQELKERWGEDWAFSGITTFGHLEHVHCLTNPDTP
FDIGIIGTPFDTAVSYRPGARMGPRAIRTASARHIPSRAFHAAAQINPYQSWAKVLDCGD
IPVTPFDNAVAIHQMTEAYRELGSRRTTTGTGKPKLITLGGDHLVALPALRALRESYGEP
MALLHFDSHLDSLHPDRYPSAWTSMQSQFNHGSVFWNAMKEGLISNSSSLHAGINTRLSG
NSFQDLDDDDKQGFLRIAADEVDSIGAAGIIDRIHQHIPKDQPVYMSIDIDVLDPAFAPG
TGAPEPGGWTTREMIKILRGVMDLNIVGADIVEVAPAYDTPGGETAYLAANLAYELVTGM
VAREQKAGGRAGGRQVPVGMMQEPNEYEVCYRLNPGAETVLNGLLKQIS
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgttactctctgtggtggtccatttttggtcttattggagggtcctccgccactcaa
gcttcgccggcccacgtgcaggagctcaaggaacgctggggtgaggattgggcattttcg
ggcattaccactttcggccacttggagcatgtccattgtctcacaaatcccgacacgccg
tttgacatagggatcattggcacgcctttcgatacggccgtgagctaccgacctggtgcg
cgcatgggccctcgtgccattcgcaccgcttctgcccgtcatatcccatctcgcgcgttt
cacgctgcagcccaaattaacccgtatcagtcatgggcgaaggttctggactgtggagac
atccccgtcaccccctttgacaatgcggtggccatccatcaaatgaccgaggcctaccga
gagctgggctctcgaaggacgaccaccgggacgggcaagcccaagcttatcacgctcgga
ggagatcatctcgtggcactgcccgccctccgagctctccgcgaatcgtacggcgagccc
atggcactcttgcacttcgattcccatctcgactcgttgcatcccgatcggtacccctcc
gcctggacttcgatgcaatcccagttcaatcacggctccgttttctggaatgccatgaag
gaaggactcatctccaattcgtcgtcactgcatgctggcatcaacactcgcctaagtggg
aactccttccaggacttagatgacgacgacaagcagggattcttgcgcattgctgccgac
gaggttgactccattggcgcggccggcatcatcgatcgcattcatcagcatattcccaaa
gatcagccagtgtacatgagcatcgacatcgatgtactggatcccgcgtttgccccaggg
acgggagcccccgaaccgggtggctggaccacgcgcgagatgatcaagattttgcggggc
gtcatggatctcaacattgttggagctgatatcgtcgaggtggccccggcctacgacacc
ccggggggtgaaactgcgtatctggcggcaaacctggcctacgaactggtcactggcatg
gtggccagagaacagaaggccggcgggcgggcgggcgggcgacaagtccccgtagggatg
atgcaggagcccaacgaatatgaggtttgctaccgcctgaatcccggagcggaaactgtt
cttaatgggcttttgaaacaaatcagctag

DBGET integrated database retrieval system