KEGG   Aspergillus niger: ANI_1_352044Help
Entry
ANI_1_352044      CDS       T01030                                 

Gene name
An05g00120
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ang  Aspergillus niger
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ANI_1_352044 (An05g00120)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ANI_1_352044 (An05g00120)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ANI_1_352044 (An05g00120)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MASKRLTIVIKLGTSSIVDENTHEPILSILTLIVETAAKLHRDGHNVVLVSSGAVGVGLR
RMDIDERPKHLPRIQALAAVGQCRLMSLWDGLFSHLRLPVAQILLTRNDIADRTQYLNAQ
NTFAQLFDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVKADYLFLMTDVDCLYTAN
PRHNPDAKPIEVVTDISSLEADVSSAGSSLGTGGMSTKIVAAKLGTSAGVTTIITKSSKP
GNVHEIVRYLQQTEQLGLESGDSTSSLELRTPPPLHTRFIPSQTPIQSRSFWLLHGLKPR
GTLYIDHGAYSALQKKAGLLPAGVVGVEGHFGQQEAVRLVVVEKISPDALNGEFLHHGQE
PKEVGRALVNYGSSEIVRIKGQRSTHIQSLLGYADSEYVALRENISFTQSNDSPRH
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaacgtctcacgatcgtcatcaaattagggacgagctccatcgtggatgag
aacacccatgagcctatactgtctatattaaccttaattgtggagaccgccgcaaaactt
catcgcgacggacataatgttgtgctcgtttcgtccggtgctgtcggcgttggtttacgg
agaatggatatcgacgagaggccgaaacacttgccccgtatacaggccttggccgcggtt
ggacaatgtagactgatgagtctttgggacggtcttttctcgcatctccgtctcccggtc
gcacagatcttgttgaccagaaatgacattgcggataggacacaatatctcaatgcccaa
aataccttcgcacagttattcgacatgggtgtgatccccatagtcaatgagaacgacact
ctcgctgtctcggaaatcaaattcggtgacaatgacacactgtcggcaataacagcagct
atggtcaaagccgattacctcttcttaatgacggatgtcgactgtctatacacagctaac
ccacgccacaacccagatgcgaagcctatcgaggttgtcacggatatttcgtctttggag
gccgatgtctcgtctgccggatcttctttagggacaggaggcatgagtaccaagattgtc
gctgctaaattggggaccagtgcgggcgtgaccacaatcattaccaaaagctctaaaccg
ggtaatgtccatgaaattgtcagataccttcagcaaacggagcaacttggcctggagtct
ggagattctacgagctcgttagaattgcgcacaccgcccccactacacactcgattcatt
ccttcgcaaaccccaattcagtcccgatctttctggctccttcatggcctgaaaccaaga
ggtacactatatatcgatcatggtgcttatagtgctctccagaaaaaggctggcttgctc
ccggcaggcgttgtgggggtggaaggtcatttcggccaacaggaagcagtgcgcttggtt
gtggttgagaagatctcgccagacgccctgaatggggagttcctacaccatggccaggag
ccgaaggaagttgggcgtgccctagtcaattacggcagcagtgaaatcgtccgcatcaag
ggccagagaagcacacatattcaatcactactcggttatgcagatagtgaatatgtggct
cttcgagagaacatctctttcacacagagtaacgacagtccacgtcattga

DBGET integrated database retrieval system