KEGG   Aspergillus niger: ANI_1_376154Help
Entry
ANI_1_376154      CDS       T01030                                 

Gene name
An17g00200
Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ANI_1_376154 (An17g00200)
Enzymes [BR:ang01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     ANI_1_376154 (An17g00200)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ANI_1_376154 (An17g00200)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 282 aa AA seqDB search
MGDSATPEAPSHPPVERSREDGRERKLLHFIYDQPNRDEIQGNPAKVLDLIEEFGKTYHF
MNIGRAKGKFIIDIIEEKKPEVMIELGGYVGYSAILFGDAVRRAGGRHYYSLELNPEFAA
IANMLLELAGLRDFVTILVGRSDLSLDKLFSSGHVKHVEVMLIDHYKPAYTADLKLCEQL
GKIVPGVSVVVADNVLYPGNPPYLEYVRSTVEQKREAAKKGPVQAYDTTNLPQRSVGSFM
PADATPSFELTGNPNLVYDSKLVKPETTRDAIEVSRCVGIQE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatagtgctacccccgaagccccttctcaccctccagtggaacgttcgcgcgag
gatggccgagagcgaaagctgcttcacttcatctatgaccaacccaaccgtgacgagatc
cagggcaacccagcaaaggtcctagatctgatcgaagagttcggtaaaacttaccacttc
atgaacatcggtagggccaagggcaagttcattatcgacatcatcgaggaaaagaagccc
gaagttatgattgagcttggtggctatgttggctattcggccattctgttcggagatgcc
gtgcgccgggctggcggacgacactattatagtttagagttgaaccccgagttcgcggcc
atcgcgaacatgctgcttgaactggcgggcttgcgcgactttgttacaattctcgtcggt
cgaagcgatttgtcccttgacaaacttttctcgagtggtcatgtcaaacacgttgaagtg
atgctaattgatcactataagcccgcatatacggccgatctgaagctctgcgagcagctc
ggcaagatcgtccccggggtttcggttgtggtggcggacaacgtgctctaccccggcaac
ccgccgtatttggagtatgtccgcagcacggtggagcagaagcgtgaagcggccaaaaag
gggccggtccaagcatacgacactaccaacctgccacagagatcagtcgggtcattcatg
cctgcggatgcgacgcccagctttgaactcaccgggaacccgaacctggtgtatgacagc
aaattggtcaaacccgagaccacacgagacgcgatcgaggtgagccgatgtgtggggatc
caggaatga

DBGET integrated database retrieval system