KEGG   Aspergillus niger: ANI_1_376154Help
Entry
ANI_1_376154      CDS       T01030                                 

Gene name
An17g00200
Definition
O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ang  Aspergillus niger
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ang00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 282 aa AA seqDB search
MGDSATPEAPSHPPVERSREDGRERKLLHFIYDQPNRDEIQGNPAKVLDLIEEFGKTYHF
MNIGRAKGKFIIDIIEEKKPEVMIELGGYVGYSAILFGDAVRRAGGRHYYSLELNPEFAA
IANMLLELAGLRDFVTILVGRSDLSLDKLFSSGHVKHVEVMLIDHYKPAYTADLKLCEQL
GKIVPGVSVVVADNVLYPGNPPYLEYVRSTVEQKREAAKKGPVQAYDTTNLPQRSVGSFM
PADATPSFELTGNPNLVYDSKLVKPETTRDAIEVSRCVGIQE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatagtgctacccccgaagccccttctcaccctccagtggaacgttcgcgcgag
gatggccgagagcgaaagctgcttcacttcatctatgaccaacccaaccgtgacgagatc
cagggcaacccagcaaaggtcctagatctgatcgaagagttcggtaaaacttaccacttc
atgaacatcggtagggccaagggcaagttcattatcgacatcatcgaggaaaagaagccc
gaagttatgattgagcttggtggctatgttggctattcggccattctgttcggagatgcc
gtgcgccgggctggcggacgacactattatagtttagagttgaaccccgagttcgcggcc
atcgcgaacatgctgcttgaactggcgggcttgcgcgactttgttacaattctcgtcggt
cgaagcgatttgtcccttgacaaacttttctcgagtggtcatgtcaaacacgttgaagtg
atgctaattgatcactataagcccgcatatacggccgatctgaagctctgcgagcagctc
ggcaagatcgtccccggggtttcggttgtggtggcggacaacgtgctctaccccggcaac
ccgccgtatttggagtatgtccgcagcacggtggagcagaagcgtgaagcggccaaaaag
gggccggtccaagcatacgacactaccaacctgccacagagatcagtcgggtcattcatg
cctgcggatgcgacgcccagctttgaactcaccgggaacccgaacctggtgtatgacagc
aaattggtcaaacccgagaccacacgagacgcgatcgaggtgagccgatgtgtggggatc
caggaatga

DBGET integrated database retrieval system