KEGG   Aspergillus niger: ANI_1_384044Help
Entry
ANI_1_384044      CDS       T01030                                 

Gene name
An05g00510
Definition
NADPH cytochrome P450
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ANI_1_384044 (An05g00510)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 716 aa AA seqDB search
MTSPLPPWQLSPALWQELTKALTPTGVADYAALTLLAMAGTTYLSRGILWDQPDPYNYLW
YERPQLKMAGSAGPNAHQETRNIAQKLEEADKNIVVFWGSQSGTSEGFAHRLAREIALRF
RQGTLTADLSDYDPESIAQIPQSKLAIFILSTYGEGDPSDNTAEFWDWIHKAENVSLANV
RYCAFGLGNSNYKFYNRVVDVVVQALDGRGAKALMPVGRANDAEGATQEDFISWKDELFA
MFKSQLGFEEGEMQYLPTLSVEEDESLEPIDLNHGEPDARDASRASAQCSPVRPVTISST
RELFQVSDRHCLHMEMDLSSVPEFTYKTGDHLAIWPSNPDAEVERLLQVLGLTARREVPI
SIKSLDPATKVRIPTPTTAAALFRYYLEICAPVNRDTVLGLAQFAPTPEAKTYLLQLGQD
KTSYANFLNCTHVTLSRLLQLASPDNAWSALPLSYLVETLAPIQPRYYSISSSSVLSPRK
PSITAIVSTTPVPENPDELIHGITSNYLLALSQHRSSPSTPHPYGLTYHLNGPSNALNSE
KVFTHLRKSKFKLPRTGNIPLIMIAAGTGLAPFRAFISERRQLQQIGREVGQMILFFGCR
RPDEDYIYKEELDALQEGLGGKLRIETAFSRYENEGMKRQYVQDKIVECGDEVVRLLVEE
RANLYICGRAGMAREVEKRVGGEMCRVKGWDEGDGQWNEWCKGLKKRGKWQEDVWG
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgacctcccctctgcctccatggcagctatcgccagccctctggcaggagctgaccaaa
gccctcactcccactggagttgccgactatgccgccctgactctcctcgccatggcgggc
acaacctacctgtcacgcggcatcctttgggaccaaccagatccctataactatctctgg
tatgagcgtccccagctgaagatggccggttccgccggtcccaatgcccaccaagagacc
cgcaacattgcccagaagctcgaagaggcggacaagaatatcgtcgtcttctggggatca
cagtccggtacatccgagggctttgcccatcgattggcgcgcgagatcgccctccgcttc
cgccagggtactctgactgctgatctatcagattatgatccggagagtatcgcccagatt
cctcagtccaagctggcgatttttatcctgtctacgtatggcgagggagaccccagtgat
aacacggctgagttctgggactggattcacaaggccgagaatgtctccctggccaatgtg
aggtattgtgcgtttggtctggggaatagcaattacaagttctacaaccgcgtcgtggat
gtggtcgttcaggcgctggatggtcgaggcgcaaaggctctcatgcccgttggtagggct
aatgacgccgagggcgccacgcaggaggactttattagctggaaagacgagctgtttgcc
atgttcaagtcccagctcggcttcgaggagggtgagatgcagtacctgcccaccctatcc
gtcgaggaagatgagtccctggagcctattgatctgaaccacggcgagccagatgcccgt
gatgctagtagggcatctgcacaatgctcccctgtgcggccagtgactatctccagtacc
cgtgagctcttccaggtctcagaccgccactgcttgcacatggagatggacctgtccagc
gtccccgagttcacctacaagacgggtgatcacctcgccatctggcccagcaaccccgac
gcagaggtcgagcgtctcctccaggtgttgggccttactgcacgccgcgaggtgcccatc
tccatcaaatctctggacccggccacgaaagtgcgcatcccaacgcccacgaccgcggca
gccctcttccgctactacctggagatctgtgctcccgtgaaccgcgacacggtactaggt
ctagcacaattcgcacccaccccggaagcaaagacatacctccttcaactaggccaggac
aagaccagctacgccaacttcctcaactgcacccatgtcaccctcagtcgtctcctccaa
ctcgcctccccagacaatgcctggtccgccctacccctatcctacctggtcgaaaccctc
gcccccatccaacctcgatactactccatctcctccagcagcgtgctctcgccccgcaaa
ccttccatcaccgccatcgtctccaccacgccagtccccgagaacccggacgaactcatc
cacggcatcacctccaactacctcctcgcattatcccagcaccgctcatccccatcaacc
ccccacccttacggcctaacctaccacctcaacgggcccagtaacgccctcaacagcgag
aaggtcttcacccacctccgcaaaagtaaattcaaactgccccgcaccggaaacataccc
ctcatcatgatcgccgcgggcacgggcctggccccgttccgagcattcatctccgagcgc
cgccagttgcagcagatcggccgcgaagtgggacagatgatcctcttcttcgggtgtcgg
cgcccggacgaggattatatctataaggaggaactggatgcgttgcaggaggggctggga
gggaagttgcgcattgagacggcgttttcgaggtatgagaacgagggaatgaagaggcag
tatgtacaggataagattgtcgagtgtggggatgaggtggttagattgttggtggaggaa
agggcgaacttgtatatttgtggaagggcggggatggctagagaggttgagaagagggtt
gggggggagatgtgtagggtgaaggggtgggatgaaggtgatggacagtggaacgagtgg
tgtaaggggttgaagaagagggggaagtggcaggaggatgtctggggttag

DBGET integrated database retrieval system