KEGG   Aspergillus niger: ANI_1_392024Help
Entry
ANI_1_392024      CDS       T01030                                 

Gene name
An02g02920
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ang  Aspergillus niger
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ANI_1_392024 (An02g02920)
   01230 Biosynthesis of amino acids
    ANI_1_392024 (An02g02920)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ANI_1_392024 (An02g02920)
   00051 Fructose and mannose metabolism
    ANI_1_392024 (An02g02920)
   00562 Inositol phosphate metabolism
    ANI_1_392024 (An02g02920)
Enzymes [BR:ang01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ANI_1_392024 (An02g02920)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ANI_1_392024 (An02g02920)
  Exosomal proteins of bladder cancer cells
   ANI_1_392024 (An02g02920)
  Exosomal proteins of melanoma cells
   ANI_1_392024 (An02g02920)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 282 aa AA seqDB search
MASQQAYPVLPKNLLIISLKMYFTPTRTLDYCRALLDPKNDIVRPENRSKLLLALIPDFL
TVYPCAEIIKAWESTLPKDDAPSLPAPFLLGAQDCFWEPLGAYTGEVSPLALRSMGVSIV
ELGHAERRAIFGETDDQTGRKAAAACAQGMVPLVCIGEVTAPGPVASQAIGQAVSECEVQ
IRAVLQAIPADAPVIFAYEPVWAIGKPAPAGVDHISAVVDGIKAVIGTRAGDVRILYGGS
AGPGLWGPGGLGKAVDGMFLGRFAHEVEGVRKVVREVEETLA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccagcaagcctacccggttctcccaaagaacctgctcatcatctcgctgaag
atgtactttacacctacccgtacgctcgactactgccgtgctttgctcgaccccaagaat
gatattgtccgcccggagaaccgttccaagctgttgctggcccttatccccgacttcctg
accgtctacccctgtgcggagattattaaggcgtgggaatccactttaccaaaggatgat
gctccttcactgccagctccattcctgcttggggctcaggattgcttctgggagccactg
ggcgcctacaccggagaagtctcgccgctggcgctccgctcgatgggggtgtccattgtc
gaacttggtcacgcagaacgccgcgccatctttggcgagacagatgatcagactggccgc
aaagctgccgctgcatgcgcacaaggtatggttccgctggtctgcatcggagaggtcacc
gcgcctggccccgtagcctcgcaggccatcgggcaggccgtcagcgaatgcgaggtccag
atccgggccgtcctccaggccatcccggcggacgcgccagtcatctttgcctacgaaccg
gtgtgggcaattgggaagcccgccccggcgggtgtagatcacatatcggcggtggtcgat
ggcatcaaggcggtgattggcacccgcgcgggggacgtccggatcttgtacgggggaagt
gccggaccggggctgtggggcccgggcggtctggggaaggccgtcgacggcatgttcctg
ggccgattcgcccacgaagtcgagggggtccgcaaggtggtcagggaggttgaggagacg
ttggcttga

DBGET integrated database retrieval system