KEGG   Aspergillus niger: ANI_1_396144Help
Entry
ANI_1_396144      CDS       T01030                                 

Gene name
An16g02820
Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ang  Aspergillus niger
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ANI_1_396144 (An16g02820)
  Amino acid metabolism
   00380 Tryptophan metabolism
    ANI_1_396144 (An16g02820)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ANI_1_396144 (An16g02820)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     ANI_1_396144 (An16g02820)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1104 aa AA seqDB search
MGSVKPVPIPGPKGVPFLGNVYDIDQEMPVRSFELMADQYGPIYRLTTFGLSRVVVSTQE
LVDEVCNEERFAKSVDGGLGQLRNLLHDGLFTARYPGEENWALAHRVLIPAFGPLSIRGM
FDEMQDIANQLVMKWARQGPETPIVVTEDFTRLTLDSIALCAMGTRFNSFYHDSMHPFVE
AMVGGMQVASYRAQRPSFLNQLPTSENNAFWNDISYMRNLAKELIEDRRKHPSDKKDLLN
ALILGRDPQSGKGLSDESIIDNMITFLIAGHETTSGMLSFVFYYLLKNAHAYKKAQEEVD
RVIGRRKITVDDLSKLPYINAVMREALRLNPPASVMRVHAHPTKNKEDPVTLGNGRYVLN
KDEPITVLLPKLHRDPKVYGADAEEFKPERMLDENFNSLPRNSWKPFGNGMRGCIGRPFA
WQEGLLAIALLLQNFNFQLDDPSYDLRIKQTLTIKPKDFKMRATLRHGLDPITLEPALNS
GSVPRESSTVASRERKKDAALSEGDMKPMHIFFGSNTGTCEALARRLADDAVAWGFSAKV
NSLDSATENVPKGDPVVFIAASYEGQPADNAAHFFEWLSAANDNELEGINYAVFGCGHHD
WTATFYRIPKAINELVKEHGGNRLCDIGLVDTAIADMFTDFDNWSESALWPAISSKFGSK
SQGQAGKKASSGLQVELSSEKRVTTLGLQLQEGYVIENKLLTAPDVSAKRLVRIKLPSDM
TYQCGDYLAVLPVNPTSIVRRAMRRFKLPWDAFLTVRKSSQTQNGPSAIPTDTPISAFAL
LSSYVELSQPASKRDLTALADAAVADEESQAELRYMANSPSRFNEEVVTKRLSLLDILDR
YPSIGLPLGDFLAMLPPMRVRQYSISSSPLTDPTECSITVSVLNAPSLSGTDEPYMGVAS
TYLSILQADERIHIAVRPSHSGFKPPADLNTPMIMACAGSGLGPFRGFVMDRAEKILSRS
DSITEKPAPAILYVGCRTKGKDDIHAEELAEWSRQGIVDVRWAYSRPSDGSVAQHIQDRI
TSDRDEVVSLFEQGARIYVCGSAEVGKAVRQAFKNIYVDVKQERRRVALETKQEEVPSEV
NDEDVEKFFDDLKASMRYATDVFT
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtaaagcctgttcctatcccaggccccaagggcgttccatttcttggaaat
gtctacgatattgaccaagagatgccagtccgaagttttgagttgatggcagatcaatat
ggcccgatctaccgactgacaacttttggcttgtcgagagtagtcgtttctactcaagaa
ctcgtcgacgaagtatgcaatgaggagcgattcgctaaatcggtggatgggggtttgggc
caacttcggaatctcctccacgacggtttattcacggctcggtaccccggcgaggagaac
tgggcgcttgcgcaccgtgtccttattcctgcttttgggcccctgtctatcagaggcatg
ttcgatgagatgcaagatatagccaaccagctcgtcatgaaatgggctcgacagggacct
gagactcctattgtggtcacagaagatttcacccgcctgactcttgactccatcgccctc
tgcgccatgggaacccgcttcaactccttttaccacgatagcatgcaccccttcgtcgag
gcgatggttggtgggatgcaggtagctagttatagggcacagcgcccatcgttcttgaac
caactgcccacaagcgaaaataatgctttctggaacgatatttcttatatgagaaactta
gcgaaggagttgatcgaagataggagaaagcatccatcagacaagaaggacctgctcaac
gctctcatccttggccgagaccctcagtcagggaagggcctcagtgatgagtcgatcatt
gacaacatgatcacctttttgattgcaggccacgaaaccacttctggaatgctgtcgttc
gttttctactatctactaaaaaacgcacatgcgtataaaaaggcacaggaagaagtcgac
agggtgattggccgacggaagatcaccgtggatgatctctccaagttgccgtatatcaat
gcagtcatgcgagaagcgctacgcctcaacccgccagcgagtgtcatgagagtccatgcg
catccgactaagaacaaagaagacccagtgaccttgggtaatggaagatatgttctgaac
aaggacgagccaatcacggttctcctcccgaaattacaccgcgatcccaaggtctacggt
gcggatgccgaggagttcaagccggagaggatgctagatgaaaatttcaacagtctccct
cggaattcctggaagccttttgggaacggcatgcgcggttgtattggacggccatttgcc
tggcaagaaggcttactggctattgctttgctattgcagaatttcaacttccagctggat
gatccaagctatgacctgcgcatcaaacagacactcaccatcaagccgaaggacttcaag
atgagagcaactctcaggcatgggttggacccaataactttggagccagctctgaacagt
ggttctgtgcctcgtgaatcctccacggtagctagcagggaacgtaagaaggatgcagcc
ctttccgagggagacatgaagccgatgcacatattttttggcagtaatactggaacctgc
gaggctttggctcggagactggcagatgatgctgtcgcatggggatttagtgccaaagtc
aattcgctagattccgccactgagaatgttccgaaaggggatccagtggttttcattgct
gcatcttacgaaggccaacccgctgataatgcggctcattttttcgagtggcttagcgca
gcaaatgataatgaactcgaagggataaattatgccgtattcggttgtggacatcatgat
tggactgccacattttaccggatccccaaagctatcaacgagctggtgaaagagcatggt
gggaatcgcttgtgtgatatcggattagttgataccgccattgcagacatgttcactgat
ttcgataactggagtgagtcggcgttatggcctgccataagctcgaaatttggctccaaa
agtcagggccaggctggtaaaaaagccagttcgggcctacaagtcgaactcagctcagaa
aagcgagtgactaccttgggccttcagctgcaggaaggatatgtgatcgagaacaagctt
ctaacagcacccgacgtttcagcgaaacgactggtgagaatcaagcttccaagcgacatg
acttatcagtgcggtgattaccttgctgtgcttcccgtgaacccaactagcatcgtccgt
cgagcaatgcgtcggttcaaactgccttgggatgcctttttgactgttcgcaagtcatcc
cagacccaaaatggaccgtcagccattcccactgacacccccatttccgccttcgcactc
ctctcctcctatgttgaactatcccagcccgcgtccaaacgagacctgactgccctggca
gatgcagccgtggccgacgaagaatcccaggccgagctgcgatacatggccaacagtcct
agccgcttcaatgaggaggtcgtcacaaaacgcctcagcttgctggacatcttggatcgt
tatccttccatcggtctaccgctcggcgacttcctagctatgctcccgcccatgcgagta
cgccagtactctatatcatcctcaccccttacggacccgacagaatgctctattacagtg
tccgtgctcaacgcaccctctctctccggcacagacgagccgtacatgggcgtagcttct
acatacctttccattctccaagctgacgaacgcattcacatcgccgtccgcccgtcccac
tccggcttcaaacctcccgcagacctcaatacgccaatgataatggcctgcgcaggaagc
ggcttagggcctttccgcggatttgtcatggaccgggcagaaaagattctcagccgaagc
gactctatcactgaaaagcccgccccggctatcctctacgtcggctgtcgcaccaaaggc
aaggatgacattcacgcagaagagctcgctgaatggtctcgccagggcatcgtcgacgtc
aggtgggcatacagccgtccctctgacggctccgttgcccagcacattcaggaccggatt
acaagtgatcgcgacgaagtggtctcactttttgagcaaggcgctaggatctatgtgtgt
ggaagtgcggaggtaggcaaagcggtgcgccaagcgtttaagaacatttacgtcgatgtg
aaacaggagcgtcgtcgggtagcgttggagacgaagcaggaagaagtcccgtctgaagtg
aatgacgaggatgttgagaagttcttcgatgatctcaaggcaagcatgcgttatgcgacg
gacgtgtttacttag

DBGET integrated database retrieval system