KEGG   Aspergillus niger: ANI_1_398124Help
Entry
ANI_1_398124      CDS       T01030                                 

Gene name
An14g02760
Definition
endoglucanase A
Orthology
K18576  
xyloglucan-specific endo-beta-1,4-glucanase [EC:3.2.1.151]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.151  xyloglucan-specific endo-beta-1,4-glucanase
     ANI_1_398124 (An14g02760)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 239 aa AA seqDB search
MKLPVTLAMLAATAMGQTMCSQYDSASSPPYSVNQNLWGEYQGTGSQCVYVDKLSSSGAS
WHTEWTWSGGEGTVKSYSNSGVTFNKKLVSDVSSIPTSVEWKQDNTNVNADVAYDLFTAA
NVDHATSSGDYELMIWLARYGNIQPIGKQIATATVGGKSWEVWYGSTTQAGAEQRTYSFV
SESPINSYSGDINAFFSYLTQNQGFPASSQYLINLQFGTEAFTGGPATFTVDNWTASVN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccctgtgacacttgctatgcttgcggccaccgccatgggccagacgatgtgc
tctcaatatgacagtgcctcgagccccccatattcagtgaaccagaacctctggggcgag
taccaaggcaccggcagccagtgtgtatatgtcgacaaactctccagcagtggtgcatcc
tggcacaccgaatggacctggagcggtggtgagggaacagtgaaaagctactctaactct
ggcgttacatttaacaagaagctcgtgagtgatgtatcaagcatccccacctcggtggaa
tggaagcaggacaacaccaacgtcaacgccgatgtcgcgtatgatcttttcaccgcggcg
aatgtggaccatgctacttctagcggcgactatgaactgatgatttggcttgcccgctac
ggcaacatccagcccattggcaagcaaattgccacggccacagtgggaggcaagtcctgg
gaggtgtggtatggcagcaccacccaggccggtgcggagcagaggacatacagcttcgtg
tcggaaagccctatcaactcatacagtggggacatcaatgcatttttcagctatctaact
cagaaccaaggctttcccgccagctctcagtacttgatcaatctgcagtttggaactgag
gcgttcaccgggggcccggcaaccttcacggttgacaactggaccgccagtgtcaactag

DBGET integrated database retrieval system