KEGG   Aspergillus niger: ANI_1_438124Help
Entry
ANI_1_438124      CDS       T01030                                 

Gene name
An14g03050
Definition
lysophospholipase NTE1
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ang  Aspergillus niger
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ANI_1_438124 (An14g03050)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ANI_1_438124 (An14g03050)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1515 aa AA seqDB search
MATGDGIIAAPPSLESSSLDPLHVLPASSSTAARSLATSIPALTASFSVVSGFSSHLPPP
PVTPPAPSTMVGWIGWIFSFIFQVIPSVLYWIVTFTTITLPTWLFTLFSMSLTFTMNFTT
LLLIALAVVSTISWFIRYRFLNMYSRLPPEPQRKEPQLDLFPDVPDSDTKPGLANYLDEF
LSAIKVFGYLERPVFHELTRTMQTRKLIAGETLLLEEEKGFCLVVDGLVQIFVKSMRDRK
SGSDEELNRMAGESSDEDDHRPDGRQGYQLLTEVKNGASMSSLFSILSLFTEDVQLRYAD
SSASSASSIGPGLAIGPDSFPASPREMDDSPHVYQGDRLDPASHRNSTAEDLPAVPPLNL
GESQVPPAHSARSESRKYSGKTRRKSVHPDIVARAMVDTTIAIIPASAFRRLTRVYPKAT
AHIVQVILTRLQRVTFATAHSYLGLNNEVLGIEKQMTKFTTYDLPNELRGSALDRLKDKF
IKERDRLGQEEVTKGIALHNPYGGRRPRSSSFRRKEAALQAKMVASKRPVSMVAQDSALS
DRENSGVSPGDLLSTIQLSRFGPRYEHLAPRLLSPLTEKEHSPLRSPSPMIPGRASPFHR
KESLDEDALFRESILECIMKGIGLTGSTNDFLRKSSHPSGDVSPKLLSYDSRRQKAVFSN
NAFGFIDPYEGSADGESESMMSMSVTSAGGTSPIVNLREELRNDIEIVYFPQGSVLVEQG
ERHPGLYYVVDGFLDVGIPVDDKEEDLVGSSRPAHEELFPMLRRTNTSSSRVSGSAAAAN
DPRRKKQSRRSLYLIKPGGIQGYVGAVASYRSYTDVVAKTDVYVGFLPRASLERIAERYP
LALLTLAKRLTSLLPRLLLHIDFALEWVQVSAGQVIYHQGDESDAIYLALNGRLRSVHEG
PNGKMTVVGEYGQGESVGELEVMTESTRPATLHAIRDTELAKFPRTLFNSLAQEHPGITI
QVSKLIAQRMRDLVETPLAEKGGEPGVSGTVKTAKSTLNLRTVGILPALHQIGVTNGATS
LNQAAILNHLGRHAFSKMGKLKLSQYLADLEEKYGMVLYIADTSVNSPWTQTCITQADCI
LLVGLAESTPSIGEYERFLLGMKTTARKELVLLHGERYCPPGLTRQWLKNRVWINGGHHH
VQMAFRLTAEPSHPQTKRFGTVLKQRVQVIQAEIQKYTSRRIRQSPLYSAQTPFKGDFHR
LARRLCGRSVGLVLGGGGARGIAQVGVIKALEEAGIPIDVIGGTSIGSFIGALYARDADV
VPMYGRAKKFAGRMGSIWRFALDLTYPTVSYTTGHEFNRGIFKTFGDSQIEDFWLEFYCN
TTNISRSRAEYHSSGYTWRYVRASMSLAGLIPPICDEGSMLLDGGYIDNLTVDHMKGLGA
DVIFAVDVGSIDDNTPQVYGDSLSGFWAVVNRWNPFSSCPNPPTLSEIQARLAYVSSIEN
LERAKNTPGCLYMRPPIDPYGTLDFAKFDEIYQLGYAYGKNYLEKLKREGSLPLPEETEE
KKKLQRTLAPRRASI
NT seq 4548 nt NT seq  +upstreamnt  +downstreamnt
atggccaccggtgacggaatcatcgctgcaccaccctcgcttgaatcttcaagcctggac
cctctccatgtgttgcctgcatcctcatcgaccgccgcacgatccctcgcaacctcaatc
cccgccttaaccgccagtttctccgtggtgtccggcttctcttcgcatctccctcccccg
ccagtaacccccccagcaccttcaaccatggtggggtggatcggctggatcttttccttc
atcttccaggtcattccaagtgttctatactggattgttaccttcacgaccatcaccttg
cccacatggctgtttacgctcttttctatgagccttaccttcaccatgaacttcacgacc
ttactcttgatcgcgctggccgtggtctcgaccatcagttggtttatccgctatcgtttc
ctgaacatgtacagtcgtctgcctccagaaccgcagcgcaaggaaccccagctcgatctc
ttccccgatgtaccggacagcgacacgaaaccgggcttggcaaactatctggatgagttt
ctgagcgctatcaaagtcttcggctacctcgagcggcctgtattccacgaattgacccgc
accatgcagacaaggaagttgatcgccggcgaaacgctcctgctggaggaagagaaaggg
ttttgtttggtcgttgatggcttggtccaaatcttcgtgaagtccatgcgggacagaaag
tcgggctcagatgaagagctgaaccgcatggcaggtgaatcttccgacgaagacgaccat
cgaccggacggaaggcaaggataccagctgcttaccgaagtaaagaatggagcttcgatg
tcctcgctcttttccatcctgtcgctgtttaccgaggatgtccaattacgatatgcagac
agctcagcttccagcgcttctagtataggtccgggtcttgccattggccccgactcattt
ccggcgagccctcgggaaatggacgactctccgcatgtttatcaaggggatcgtcttgac
ccggcctcgcacaggaacagcactgccgaagacctaccagctgtgccgccattaaatctg
ggtgaaagtcaagttccacccgcccactctgctcgctctgaaagcagaaagtactcaggc
aaaacgcgtaggaaatcagtgcatccagatatcgttgcacgagcgatggtagacacaaca
atcgcaatcatccctgcaagcgcattccgtcgcttgacccgagtgtacccaaaagcgact
gcccatatcgtccaggtaatccttacgcgcctacagagagtcaccttcgctacagcgcac
tcctatctgggtctaaacaatgaggtgctgggaatagagaagcagatgacgaaattcaca
acgtacgatttgccaaatgagctgcgtgggtcagcgctggaccgtctcaaagacaaattt
atcaaagaacgagatcgcctaggccaagaggaagtaacgaaagggattgcgttgcataac
ccatatggaggacggaggccccggtcgagtagctttcgaaggaaggaagccgctcttcag
gcaaagatggtcgcctctaaacggccagtctccatggttgcccaggatagcgcactaagt
gatcgcgagaattccggtgtgagtcccggggatcttctatctaccattcagctttcgcgc
ttcggtccgagatacgagcaccttgccccccggttactgagtcctcttacggagaaagaa
cactcccccttacggtccccgtctccaatgattccaggacgcgcatctcctttccaccgg
aaagagtctttggatgaggatgcactcttccgtgaatcaatcctggagtgtatcatgaaa
ggcatcggcttgactggaagcaccaatgacttcttgcgtaaaagtagtcacccttcaggc
gatgtttccccgaagctcctctcctatgattctcgccgccagaaagccgtctttagcaac
aacgcgtttgggttcattgatccctacgaaggttctgcggatggtgagagcgaatccatg
atgtccatgtctgtcaccagtgccggtggcacctcgcctattgtcaacttgagggaagaa
ctccgaaatgacattgaaattgtctatttccctcagggatcggttcttgttgagcaaggc
gagcgccatccgggtttgtactacgttgttgatggcttcctggatgttggtattcctgtg
gacgacaaagaagaagaccttgtgggatcatccagaccggcacatgaggaactgttccct
atgttaagacgcaccaacacgagttcctctcgtgtgtcaggctcggcagcggcagcaaat
gatcctaggcggaagaagcagtcgcggaggtcactctatcttattaagcccggtgggatc
caaggctatgtgggcgccgtcgcatcttaccgctcgtataccgatgtcgttgcgaagaca
gacgtatacgtaggatttcttccgcgggcgtcattggaaagaatagcggagcggtaccct
ctggccctgctgactttggcaaagcggctgacaagcctgctcccacggttacttcttcat
atcgacttcgccctggaatgggtgcaagtaagtgctggccaggtgatttatcaccagggt
gacgagagcgatgcaatctaccttgccttgaatggacgtttgcggtctgtacatgaaggt
ccaaatggcaagatgaccgttgtcggtgaatacggccagggagaaagcgtgggtgagttg
gaagtgatgaccgaatcgacccggccggcgactctccatgccatccgcgacactgaactc
gccaaatttccccggactctcttcaacagcctcgcccaggaacatccgggaatcactatt
caggtctccaaactcattgcacaacggatgcgggaccttgtcgagactccgctggccgag
aagggaggtgaacctggtgtttctggtacggtgaagacagcaaagtcgactctcaacctt
cgtactgttggcatacttcctgcgcttcaccagattggggtcaccaacggcgccacgtct
ctcaatcaagcggctattctgaaccatctaggaagacatgccttcagtaagatgggcaaa
ctcaagttatcacagtacctggcggatctggaggagaagtacggcatggtcctctacatt
gcggatacgagcgtgaactctccgtggacgcaaacatgtattactcaagctgactgtatc
ttgctggttggtcttgccgagtcgacgcccagcatcggtgaatacgagagatttctcctt
gggatgaaaacaaccgctcggaaagaattagtcctgttgcatggggaacggtactgccct
ccgggactgacccgccagtggttgaagaatcgtgtctggatcaatggaggccatcatcat
gtacagatggccttccgactgacggccgaaccctctcatccccagaccaaacgctttgga
accgtcttgaagcagagagttcaggttattcaagctgaaatccagaagtacacctcgcgc
cgtatccgccagtcaccgctatactctgcacagacaccattcaagggcgactttcatcgc
ttggcgcgtcggctctgtggccggtcggtggggcttgtgcttggtggtggaggtgccaga
ggtattgcccaggtcggggtaatcaaagctctagaagaagcaggcatcccaattgatgtc
attggcggcacttcgattggttctttcattggagctctgtatgcacgggatgctgacgtt
gtgcccatgtatggtcgtgcaaagaagtttgcgggccgcatgggaagcatctggcgattc
gccctggacctgacctaccctactgtttcctataccactgggcatgaattcaaccgtggc
atcttcaagacgtttggggatagtcagattgaagacttctggctcgagttctactgcaac
accaccaacattagccgatcgcgtgccgaatatcactcttctggctacacgtggcggtac
gtacgtgcatccatgtcattagctggcttgatcccgccgatctgcgacgaaggtagcatg
ctgcttgatggcggctacattgacaatcttacggtcgaccatatgaaagggctgggtgcg
gatgtgatttttgcggtggacgtgggatcgattgatgacaacaccccgcaagtgtatggc
gactccctgtccgggttttgggcagtggtgaaccgctggaatccgttcagctcgtgtcct
aacccaccaacgctgtctgagattcaagcacgcctggcgtatgtgtcgtcgatcgagaac
ctcgaacgtgccaaaaacacccctgggtgcctgtacatgcgcccgcccattgatccatac
gggacgctggactttgcgaagtttgacgagatctaccaactgggctatgcgtatggtaag
aattacttggaaaagctgaagcgggagggatcacttccgcttcccgaagagaccgaggag
aagaagaagctccagcggacgctggcgccccgtcgcgcgagtatctaa

DBGET integrated database retrieval system