KEGG   Aspergillus niger: ANI_1_438184Help
Entry
ANI_1_438184      CDS       T01030                                 

Gene name
An04g02070
Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
ang  Aspergillus niger
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ANI_1_438184 (An04g02070)
Exosome [BR:ang04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANI_1_438184 (An04g02070)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1679 aa AA seqDB search
MAPLPIKFTELLNLTNAEIAPASIGFNSCTLESDNFVCVRQKLTEEDKPQVIIINLKNNN
EVIKRPINADSAIMHWNRNIIALKAQGRTIQIFDLTAKQKLKSSVMNEDVVYWKWFNEKC
LGLVTETSVFHWDVFDPTQTHPQKVFDRLPNLGGCQIINYRVNDDEKWMVVVGISSQGGR
VVGSMQLYSKDRGISQFIEGHAAAFASIRVEGSPLEHKLFTFAVRTQTGAKLQIAEIDHQ
EPNPRFQKKAVEVYFPQEAVNDFPVAMQVSRKYDIVYLVTKYGFIHLYDLETGTCIFMNR
ISSETIFTTAPDTESAGLVGVNRKGQVLSVSVDENTIVQYLMENPAMSGLAVKLASKAGL
PGADHLYQQQFDNLITQGNYSEAAKIAANSPRGFLRTPETINRFKNAPQTGQGMSVILQY
FGMLLDKGSLNKYESVELVRPVLQQNRKHLLEKWMRENKLEGSEELGDIVRPYDMNLALA
IYLQANVPHKVIAGFAETGQFDKILSYSKQVGYQPDYTQLLQHIVRVNPEKGAEFATQLA
NEESGALIDLDRVVDVFLSQNMIQQATSFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVA
DAILGNEIFTHYDRPRISQLCENAGLIQRALENTDDPVAIKRNIVRTDKLSPEWLMEYFG
RLSVEQTLDCMDTMLQVNIRQNLQAVVQICTKFSDLLGPQQLISLLEKYRTAEGLYYYLG
SIVNLSEDPEVHFKYIEAATAMGQITEVERICRESNYYNPDKVKNFLKEAKLTEQLPLII
VCDRFNFIHDLVLYLYQNQQYKSIEVYVQRVNPSRAPAVIGGLLDVDCEESIIKNLLSTV
DPSVIPIDELVSEVESRNRLKLLLPFLEATLATGNQQQAVYNALAKIYIDSNNNPEKFLK
ENDLYDTLTVGKYCEKRDPNLAYIAYRKGQNDLELINITNENAMYRAQARYLVERADSEI
WSFVLSENNMHRRSLVDQVIATAVPESTEPDKVSIAVKAFLEADLPGELIELLEKIILEP
SPFSDNGSLQNLLMLTAAKADKGRLMDYIHQLNEFSPDEIAEMCISVGLYEEAFEIYKKV
NNFIAAVNVLVENIVSIDRAQEFAERVELPEVWSKVAKAQLDGLRVSDSIESYIRAGDPS
NYNEVIETATHAGKDEDLVKYLKMARKTLREPAIDTGLAFCYARLDQLSELEDFLRTTNV
ADVEASGDKAYEEGYHQAAKIFYTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKQ
VNEACVNKKEFRLAQICGLNLIVHAEELQDLVRQYERNGYFDELIAVLEAGLGLERAHMG
MFTELGIALSKYHPDRVMEHLKLFWSRINIPKMIRACEDASLWPELVFLYCHYDEWDNAA
LAMMERAADAWEHHSFKDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTARIDVNRV
VRIFQASDNIPLIKPFLLNVQTQNKRAVNDAINDLLIEEEDYKTLRDSVDNYDNFDAVAL
AQRLEKHDLIFFRQIAANIYRNNKRWEKSISLSKQDKLYKDAIETSAISGKSDVVEDLLR
YFVDIGSRECYVGMLYACYDLIRPDVILELSWRHGLNDFTMPFMINFLCEQTRTIEMLKK
DNEERKSREVTQKTEEDNTPILGGTRLMLTQGPAAPAPSPMAFGQANGITPQATGFRPF
NT seq 5040 nt NT seq  +upstreamnt  +downstreamnt
atggctcctctaccgatcaagtttacggagcttcttaatctcacgaatgctgaaattgcg
ccggcatcgattggattcaactcatgtactctagaatcagacaacttcgtgtgtgtccgg
caaaagctcaccgaggaggacaagccgcaagttatcatcattaacctgaagaacaacaat
gaagtcatcaagcgcccaatcaacgcggatagtgctatcatgcactggaaccgtaacatc
atcgctctcaaggctcaagggcgcacaatccagatcttcgacctgacggcgaagcagaag
ctgaagtcatcggtcatgaacgaggatgttgtgtactggaaatggttcaatgagaagtgc
ctgggcttggtgacagagacctctgtcttccactgggatgtcttcgaccctacccagacg
caccctcagaaggtctttgataggctccctaacctcggtggttgtcaaatcatcaactac
cgtgttaatgacgacgagaagtggatggtggtggtcggaattagctcgcagggaggtcgc
gtggtgggatcaatgcagttgtactcgaaagaccgcgggatctctcagttcattgagggt
cacgcagctgctttcgcctcgatccgtgtcgagggctctcctctcgaacacaagctcttt
accttcgctgttcggacacagaccggtgctaaattgcagatcgctgaaatcgaccaccaa
gagccgaacccgaggttccagaagaaggccgtcgaggtatacttcccccaggaggcggtg
aatgatttcccagttgctatgcaggtttccaggaagtacgacattgtgtatctggtcacc
aagtatggcttcattcacctctatgacctcgagaccggcacctgcatcttcatgaaccgc
atctccagtgagacgatattcactactgctcccgataccgaatctgctggtttggtcggc
gtgaaccgcaagggtcaagttctgtctgtcagtgtcgatgagaatactattgtccagtac
ctgatggagaacccggccatgtctggtctcgcagtgaagcttgcttccaaggcgggactt
cctggtgcagaccacctgtaccagcagcagttcgacaacctcatcacacaaggtaactac
tccgaggccgccaagattgccgcgaactcgcctcgtggctttttgcgtaccccggagacc
atcaaccgcttcaagaatgctccccagaccggacaggggatgtccgtcatcctccagtac
ttcggaatgcttttggacaagggctctttgaacaaatatgagagtgttgagctcgtccgt
cccgttttgcaacagaacaggaagcaccttcttgagaagtggatgcgcgaaaacaagctc
gaaggatccgaggaactgggtgatattgttcgaccatatgatatgaacttggccctggct
atttacttgcaggccaacgttcctcacaaggttatcgccggatttgcagagactggtcag
tttgacaagatcctcagctattcgaagcaggttggatatcagccggattacactcagctc
ttgcaacatatcgttcgcgtgaatccggagaagggtgctgagtttgctactcagcttgcc
aatgaggagtccggcgctctcatcgacctggaccgcgtcgtagatgtcttcctatcccag
aacatgatccagcaggccacttcattcctcctggatgctttgaaggataacaagcccgaa
catggtcacctgcagacacgcttgcttgagatgaaccttgtcaatgcccctcaggtcgct
gatgccatccttggcaatgaaatcttcacccactacgaccgccctcgtatctctcagctt
tgcgagaatgcaggcctcatccaacgtgcgcttgagaacactgacgaccccgtggccatc
aagcgtaacattgtccgcaccgacaagctgagccccgagtggttgatggaatactttggt
cgtctctcggttgagcagactcttgattgcatggacaccatgctgcaggttaacattcgc
cagaacttgcaagcagtcgttcagatttgcaccaagttctcggacttgttggggccccag
caactgatcagcctgctcgagaagtaccgcacggccgaaggtctttactattaccttggc
agcattgtcaaccttagcgaagaccctgaggttcacttcaagtatattgaggccgccacc
gccatgggccagatcaccgaagtggagcggatttgccgtgagagcaactactacaatccg
gacaaggtgaagaacttccttaaggaggctaagttgacggagcaactgccgctgatcatc
gtgtgtgaccgtttcaacttcatccacgatttggtcctttatctgtaccagaaccaacag
tataagtccatcgaggtctacgtacagcgtgttaacccatcgcgtgctcccgctgtcatt
ggtggcctgctagatgttgattgcgaagagagcatcatcaagaatctgctctctactgtt
gatccatcggtgatccctattgatgaactcgtctcagaggtggagagcagaaacaggctc
aagttgctgttgcccttccttgaggctactcttgctacgggtaaccagcagcaggccgtc
tacaacgctctcgcaaagatctatattgatagcaacaacaaccccgagaagttcctcaag
gagaacgatctctatgacactcttaccgttggaaagtactgcgagaagcgtgacccgaat
ctggcatacattgcctatcggaagggacagaatgaccttgaactcatcaatattaccaac
gagaacgctatgtaccgtgcccaggcacgctacctcgtggagagagctgattcagaaatc
tggtccttcgttctcagtgagaacaacatgcatcggcgttcactcgtcgaccaggtcatt
gcgaccgctgtgcccgagtcgacggagcccgacaaagtatccatcgctgtcaaggctttc
ctcgaagcagatctgcccggcgagctgatcgaattgcttgagaagatcattctcgagccc
tctcctttcagcgacaacggcagtctgcagaacttgctcatgcttacagctgccaaggct
gataagggacgcttgatggattatatccatcagctcaacgaattcagccccgatgaaatt
gccgaaatgtgcatttcggttggtctctacgaggaggcgtttgagatctacaagaaggtc
aacaacttcattgccgccgtcaacgtcttggttgagaacattgttagcattgaccgcgcg
caagaatttgcggagcgtgtcgagctgccggaggtgtggagcaaggttgccaaggcccag
ctggatggtcttcgggtgtccgactccatcgagtcctatatccgtgctggtgatccctcg
aactacaacgaggtcattgagacggccactcatgctggcaaggatgaagacctcgtcaag
tatctcaagatggcccgtaagactttgcgtgagcctgccattgacacgggtctcgctttc
tgctacgcccgtctcgatcagctttccgagcttgaggatttcctgcggacgaccaatgtt
gcagatgtcgaggcttccggtgacaaggcttacgaggagggctaccaccaagctgccaag
attttctacaccagcatttcgaactgggccaagttggcaacgaccttggtgcatctggaa
gattatcaggcagccgtggaatgcgcacgcaaagccaacagtgtcaaggtttggaagcag
gtcaacgaagcttgtgttaacaagaaggaattccgccttgcccaaatctgcggtctcaac
ctgatcgttcacgcggaagagcttcaagatcttgtgcgccagtatgagcgcaatggctac
ttcgacgagctcattgctgttctggaggctggcctgggtctggaacgggcgcatatgggc
atgttcaccgaactgggcattgccctctccaagtatcaccccgaccgggtgatggaacat
ctcaagctcttctggtctcgcatcaacatccccaagatgattcgggcctgcgaggatgca
agtctctggccggaacttgtcttcttgtactgccactatgatgagtgggacaacgctgct
ttggcaatgatggagcgtgctgccgatgcctgggagcaccactcgttcaaggacatcatc
gtcaaggtggccaacctggagatctactaccgtgcactcaacttttatctgcaagaacag
cctttactcctcaccgacttgctacaggtgctcactgctcgaattgacgtcaaccgtgtc
gtgcggattttccaggcttcggacaacattcctctgatcaagcctttcttgctcaatgtc
caaactcagaacaagagggccgtaaacgatgctatcaacgacttgttgatcgaggaggaa
gattacaagactctccgtgactcggtcgataactacgacaacttcgatgccgttgcactt
gcccagcggttggagaagcatgatctgatcttcttccgccaaatcgcagctaacatttac
cgcaacaacaagcgctgggagaagtcgatctccttgtccaagcaggacaagctttacaag
gatgccatcgagacttctgccatctccggaaagtcggatgttgtcgaggatcttcttcgc
tactttgtcgatattggaagccgcgaatgctacgttggcatgctgtatgcctgctacgat
ctcatccggcccgacgttattctggagctttcgtggcgccacggtcttaacgacttcact
atgccgttcatgatcaacttcttgtgcgagcagacgcgcacgatcgagatgttgaagaag
gacaatgaagaacgcaagtcgcgcgaagtgactcagaagacggaggaggacaataccccg
attctgggtggcacgcggttgatgttgacccagggcccggcagcgccggcgccaagcccc
atggcgtttggacaggccaacggaatcacaccgcaggctaccggtttccgccctttctag

DBGET integrated database retrieval system