KEGG   Aspergillus niger: ANI_1_458074Help
Entry
ANI_1_458074      CDS       T01030                                 

Gene name
An08g03280
Definition
sphingosine kinase (SphK)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ang  Aspergillus niger
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ANI_1_458074 (An08g03280)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     ANI_1_458074 (An08g03280)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 505 aa AA seqDB search
MTTSNGPPRPSFNNADHPETRDQLLEHDATLIVSNSVSLTLGGDSLLIVDERSMRKSERG
CCGIASKTAKPTHSIALYNVLDADLSPEGLTITYAEPASKEDVSVSALRYPFAPEEKAAV
ESWTNKLLSVAYGTAKQYKRLKVLVNPFGGQGHAVKLYSSYAAPVFAAARCQVDVQETTH
GGHAVEIVEQLDVNAYDAIICCSGDGLPYEVFNGLAKKPNAGEALAKVAVAMVPCGSGNA
MAWNLCGTGSVSVAALAIVKGVRTPMDLVSITQGKTRTLSFLSQSFGIIAESDLGTDDIR
WMGAHRFTYGFLKRIMRRAVYPCDLAVKVVMDDKQAIKDHYSAYAQSQPPSRPDKGTTEQ
PDGLPELVYGTVLDELPKDWEVIPAENLGNFYAGKMAIVSKDTNFFPASLPNDGLMDIVT
IDGTLSRLTTLKMMTAIPEGDFFDMPDVKIRKALAYRLVPHEKEGYISVDGESIPFEAFQ
VEIHKGLGTVLSRSGHLYEAEGPKP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctccaacgggcctcctcgcccgtcgtttaacaacgcggatcatccggaaact
cgggatcagctgcttgaacatgatgcgacgctgatagtctccaactcggtctctctcacc
ctagggggcgactctcttttgattgtcgatgagcgttccatgcgcaaatccgagcgtggg
tgttgcggcatcgccagcaaaacagccaaacccactcactccattgcgctttacaatgtc
ttggacgccgacctgtcgcccgagggccttactatcacctatgcggagccggcctctaaa
gaggatgtctctgtgtccgccctgcgatacccgttcgcgcccgaagaaaaggcggcggta
gaatcctggacgaacaaactcttatccgttgcgtatggtaccgccaaacagtacaagaga
ctcaaggttctggtcaacccgttcggcggtcaaggccacgcggtcaaattgtactcctcg
tatgcagctcctgtctttgctgcagcccgctgccaggtggacgtgcaggaaacaacgcat
ggaggccacgccgttgaaattgtggagcaactggatgtcaatgcgtatgatgcgatcatt
tgctgctccggagatggtttgccttacgaggtttttaacggtctggcgaagaaacctaat
gccggtgaagctttagctaaagtggccgtggcaatggtgccttgcgggtccggaaacgca
atggcgtggaatctttgcggaacgggcagtgtctcagtggcggctttggccattgtaaag
ggtgtccgaacccctatggatctggtttccatcacgcagggaaagactcgcacgctgtcc
ttcctgtcacagtccttcggtatcatcgcggaatccgacctcggtacagatgatattcga
tggatgggtgctcaccgtttcacctacggatttctcaagcgtatcatgcgccgcgcagtg
tatccgtgcgatctggcagtcaaggtcgtaatggatgataaacaagcgattaaagatcac
tacagtgcttacgcgcagagccagccgcccagtcgtccggacaagggtactacagaacag
ccggacgggcttcccgagctcgtgtacggcaccgtgttggacgagctgcccaaggactgg
gaggttattccagccgagaatcttggcaatttctatgcgggcaagatggccatcgtgtcc
aaggatacgaacttcttccctgcttctctgcctaacgatggcctgatggatatcgtcacc
atcgatgggactctcagtcgcctgaccacgctcaaaatgatgaccgccattcccgaaggc
gatttcttcgatatgcctgacgtcaaaatccgcaaggctcttgcctatcggcttgttccc
cacgaaaaggagggctacatcagcgttgacggagagagcataccttttgaagctttccaa
gtggaaatccacaagggcttgggcactgtcctctcgaggtcgggtcacctatacgaagcc
gaaggaccgaaaccttag

DBGET integrated database retrieval system