KEGG   Aspergillus niger: ANI_1_458124Help
Entry
ANI_1_458124      CDS       T01030                                 

Gene name
An14g03180
Definition
profilin
Orthology
K05759  
profilin
Organism
ang  Aspergillus niger
Brite
Exosome [BR:ang04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANI_1_458124 (An14g03180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MGQHSAIWQGYVDSSLMGSGQFDKAGILSHDISGVEASSPGFTISPQELQGLAAAFKDPN
AAWGNGITVGGEKFVTIKADDRSLYGKKGKEGIVVVKAVSCVMVAHHAENVQTPNAATVV
ENLVDYINNPR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagcactccgctatttggcaaggatatgtcgattccagcttgatgggatctggc
caatttgacaaggccggtatcctgagccacgacatctccggcgttgaggcctcctctccc
ggcttcacgatctccccccaagaacttcagggccttgccgctgccttcaaggaccccaac
gctgcctggggtaacggtatcaccgttggcggagagaagttcgtcaccatcaaggctgac
gaccgcagtctgtacggcaagaagggtaaggagggtatcgttgtcgtcaaggccgtctcc
tgcgtcatggtcgcccaccacgcggagaacgtccagaccccgaatgccgctaccgtggtc
gagaacctcgttgactacatcaacaacccccggtga

DBGET integrated database retrieval system