KEGG   Aspergillus niger: ANI_1_458124Help
Entry
ANI_1_458124      CDS       T01030                                 

Gene name
An14g03180
Definition
(RefSeq) profilin
  KO
K05759  
profilin
Organism
ang  Aspergillus niger
Brite
Membrane trafficking [BR:ang04131]
 Others
  Actin-binding proteins
   Others
    ANI_1_458124 (An14g03180)
Cytoskeleton proteins [BR:ang04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     ANI_1_458124 (An14g03180)
Exosome [BR:ang04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANI_1_458124 (An14g03180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 131 aa AA seqDB search
MGQHSAIWQGYVDSSLMGSGQFDKAGILSHDISGVEASSPGFTISPQELQGLAAAFKDPN
AAWGNGITVGGEKFVTIKADDRSLYGKKGKEGIVVVKAVSCVMVAHHAENVQTPNAATVV
ENLVDYINNPR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgggtcagcactccgctatttggcaaggatatgtcgattccagcttgatgggatctggc
caatttgacaaggccggtatcctgagccacgacatctccggcgttgaggcctcctctccc
ggcttcacgatctccccccaagaacttcagggccttgccgctgccttcaaggaccccaac
gctgcctggggtaacggtatcaccgttggcggagagaagttcgtcaccatcaaggctgac
gaccgcagtctgtacggcaagaagggtaaggagggtatcgttgtcgtcaaggccgtctcc
tgcgtcatggtcgcccaccacgcggagaacgtccagaccccgaatgccgctaccgtggtc
gagaacctcgttgactacatcaacaacccccggtga

DBGET integrated database retrieval system