KEGG   Aspergillus niger: ANI_1_468014Help
Entry
ANI_1_468014      CDS       T01030                                 

Gene name
An01g03570
Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ang  Aspergillus niger
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ANI_1_468014 (An01g03570)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     ANI_1_468014 (An01g03570)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MFARQAFRCAQPLKQGFRKYSTEAPKGKSSLAPIYAAVGITGVGVGLYRYNSATAEAPAA
VDRPKVFKGGDQGWFDLKLSEIEVLNHNTKRLRFEFEDKEALSGLQVASALLTKFKPADA
KAVIRPYTPTSDEETPGYIDLVVKVYPNGPMSEHLHSMNVGQRLDFKGPIVKYPWETNKH
NHICLIAGGTGITPMYQLAREIFKNPEDQTKVTLVFGNVKEEDILLKKEFEELENTYPRR
FRAFYVLDNPPKEWTGGKGYISKELLKTVLPEPKEENIKIFVCGPPGMYKAISGTKNSPT
DQGELSGILKELGYSKEQVFKF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctcgtcaagctttccgctgcgctcagcccctcaaacagggcttccgcaagtac
tccacggaagcgcccaagggcaagtcttccctggctcccatctacgccgccgttggtatc
accggtgtcggtgtcggtctctaccgctacaactcggccaccgctgaggcccccgctgct
gttgaccgccccaaggtcttcaagggtggtgaccaaggatggtttgacctgaagctgtcc
gagattgaggtcctgaaccacaacaccaagcgtctgcgcttcgagttcgaggacaaggag
gctctctccggcctccaggttgcctctgccctcttgaccaagttcaagcccgccgacgcc
aaggctgtcattcgcccttacacccctaccagcgatgaggaaacccccggttacatcgac
cttgtcgtcaaggtctaccccaacggacccatgtccgagcacctgcacagcatgaacgtc
ggccagcgcctggacttcaagggtcctatcgtcaagtacccctgggagaccaacaagcac
aaccacatttgcctgatcgctggtggtaccggtatcacccccatgtaccagcttgcgcgt
gagatcttcaagaaccccgaggaccagaccaaggtcaccctggtgttcggtaacgtcaag
gaggaggacatcctcctgaagaaggaattcgaggagctcgagaacacctacccccgccgc
ttccgtgccttctacgtcctggacaaccctcccaaggagtggaccggcggcaagggctac
atcagcaaggagctcctgaagaccgtcctgcccgagcccaaggaggagaacatcaagatc
ttcgtctgcggacctcccggcatgtacaaggccatcagtggcaccaagaacagccctacc
gaccagggcgagctgtccggtatcctgaaggagctgggctactctaaggagcaggtcttc
aagttttag

DBGET integrated database retrieval system