KEGG   Aspergillus niger: ANI_1_490154Help
Entry
ANI_1_490154      CDS       T01030                                 

Gene name
An17g01825
Definition
histone-lysine N-methyltransferase, H3 lysine-36 specific
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ang  Aspergillus niger
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ang00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 853 aa AA seqDB search
MSPHDYADRQSESVADAVTAMKLESDAAPENSAMPNGGGAMIKDESSNAASNASPVPTPK
AERSRSSSRAPVKKEENYEDDGSNLKGAENNHGGNVEEKVGGDIIVKLEPGQPPKLTRSS
SQKVVPRPPQLFAHLPDSTAEAQATFDLMDACTYANKYMGYTEHAMECDCAEEWEPSVSK
NLACGEDSDCINRATKIECMGDCGCGPECQNQRFQRREYAPVAVIKTEKKGFGLRAEADL
RPHQFIFEYVGEVINEGQFRRRMRQYDEEGIKHFYFMSLSKGEFVDATKKGNLGRFCNHS
CNPNCYVDKWVVGEKLRMGIFAERHIQAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIG
GRTQTERATKLSNATIEALGIDDADGWDTAVAKRPRKKKTGEDDEEYVDSVQPKSLEENG
VTKVMAALMQCKEKWIAVKLLGRIQRCDDERVRNRVVKMHGYQILNSQLGMWKEDHNVVL
QILDILDKFPRLTRNKIIDSKIESTIQPLTSCGDERVEKKSATLLQVWSTLEPAPQPPPA
PKESRDKALQDIIDGIMNAKENTPKEKSGTPATPQASRPTPDMKDGQEKWRSYSEEKRKK
IYENTLYPHVKYVVDKFKHKLPKDDLKRYAKDVAKKLVNSDFKNNRVGDPTKIDDKQQKK
VKKFCKEFFDKAVAKHRAYEQRKAERQSKEPDSKPNDAAAEVVEDDGPDMKMSDDEDDRV
TAQDGETPTTMTEDLQGHLKRKREDEPSIGDGSMTEYTTPSSSKRQRSSTPPPPPPPPMS
PGNEQGQSGEDGNMKSDTDEPTPADKQDLDSPPPPPPPPPYPGQEMDTNNDHFNPEDGVK
ELNPSQIGIEGRV
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctcatgactacgcggaccgtcaatcagaatctgtcgcagatgcggtgaccgcg
atgaagctggagtccgacgcagcgcccgaaaactcagccatgccaaacggcggaggagcc
atgatcaaagatgaatcgtcaaacgcagcctccaacgcctcccccgtgccaaccccgaag
gcagaacgatcacggtcttcttctcgagccccggtgaagaaggaagagaactacgaagac
gatggaagcaatttgaaaggggcggagaacaaccatgggggtaatgtggaggagaaagtc
gggggcgacattatcgtcaaactcgagcctggacagcctcccaaattaacacggagctct
tcccagaaggtagtcccaaggccaccgcagttgttcgcccatctaccggatagcacagct
gaggctcaagcgacgttcgacttgatggacgcatgcacgtacgccaataaatacatgggt
tatactgaacatgcgatggaatgcgattgtgctgaggaatgggaaccgtcggtatccaaa
aatctagcatgtggtgaagactcggattgcattaaccgcgcgaccaagattgaatgcatg
ggcgattgtggatgtgggccagaatgtcagaatcaacgattccagcgaagggaatatgct
ccggtggcggtgatcaaaacggaaaagaaagggttcggtctccgggcggaggctgacctg
cgaccgcaccaattcatctttgagtatgttggcgaggtcatcaacgagggccaattccgg
cgccgtatgagacaatatgacgaggagggaatcaagcacttctatttcatgtccctcagc
aagggcgaatttgtcgatgcgaccaaaaagggtaatctcggccggttttgcaaccattcg
tgcaatcccaattgttatgtcgacaagtgggttgttggtgagaaacttcgtatgggcatt
tttgctgaacgacacattcaagctggcgaggaactcgtcttcaactacaatgtcgaccgc
tacggggcagatccgcaaccgtgttactgcggcgagcctaactgcacaggctttatcgga
ggtagaactcagactgagcgggccacaaagttgtcgaatgctaccatcgaggctttgggt
attgacgatgcagatggctgggacaccgccgtcgcgaagcggccacgcaagaagaagacg
ggagaggacgatgaggaatatgtggacagtgtgcagccgaagtccctggaggagaatggc
gtgaccaaggtcatggcggcgctcatgcaatgcaaggagaaatggatcgcggtcaagctc
ctgggacggattcagcgctgtgatgatgagcgagtccggaaccgggtggtgaaaatgcat
ggatatcagattctgaactcccagctgggcatgtggaaggaagatcacaacgtcgtttta
cagattctcgacattctcgacaagtttccccgtctgacgcgaaacaagatcatcgattct
aagatcgagtctaccatccaaccactgaccagctgtggtgatgagcgtgtggagaagaag
tcagccacgttgctacaagtctggtcgaccctcgagcccgcccctcaaccgccgccggcc
cccaaagaatcgagagacaaggcattgcaggatatcattgacggcattatgaacgccaag
gagaatacgccaaaggagaagagcggaactccggctacaccacaggcgtccagaccaacg
ccggatatgaaggatggtcaagaaaagtggaggtcatatagcgaagagaagcgaaagaag
atatatgagaacacgctctatccccatgtcaagtatgtggtggacaagttcaagcataaa
cttccgaaagacgacctgaaacgctatgccaaagacgtggctaagaaattggttaattcg
gatttcaaaaacaaccgtgttggtgaccctaccaagatcgatgacaagcagcaaaagaag
gtgaaaaagttctgcaaagaattcttcgacaaggctgtcgccaagcaccgcgcatacgaa
caacggaaagcagagcggcagtcgaaggagccagattcgaagccaaacgacgcggcagcc
gaggttgtcgaggacgacggtccggacatgaagatgtctgacgatgaggacgatcgggtt
acagcacaggatggcgagacgcctacgaccatgacagaggatttgcaaggccatctgaaa
cgtaagagagaagatgagccaagcatcggtgatggaagcatgaccgagtataccaccccg
tcttcttccaagcgacaacgatcctctacgccgccaccaccccctcctcctcccatgagc
cctggtaacgagcaaggccaaagtggcgaagatgggaacatgaagagcgatacagatgag
cccacccctgcggacaaacaagatcttgattctcctccgcctcctccaccacctcctccc
taccctgggcaggagatggataccaacaacgaccatttcaaccccgaagacggggtcaag
gagctaaacccatcccaaattggcatcgaggggcgggtatag

DBGET integrated database retrieval system