KEGG   Aspergillus niger: ANI_1_492064Help
Entry
ANI_1_492064      CDS       T01030                                 

Gene name
An07g03980
Definition
mitogen-activated protein kinase mpkC
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ang  Aspergillus niger
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ang00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ANI_1_492064 (An07g03980)
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ANI_1_492064 (An07g03980)
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   ANI_1_492064 (An07g03980)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
MAEFLRSQILGTTFETTNRYSDLQPVGLGAFGLVCSAYDMITRQPVAIKKMMKPFSNATL
AKRTYREVKLLKHLRHENLIGLSDIFISPLEDVYLVTDLLGTDLNRLLTSKPLDGKFVQY
FTYQLLRGLKYIHSAGVIHRDLKPSNILINENCDLKICDFGLARLQEPQMTGYVSTRYYR
APEIMLTWQKYGMQVDIWSAGCIVAEMLRGKPLFPGKDHINQFFLITDALGNPPDEVIER
ICTKTTLDLVKSLPKRQPAPWATLFPDSDENAIDLLGEMLIFDPDKRISAAKALEHPYLS
VYHDPTDEPVAEQMFDWSFSEVAHSIDEWKIMIYTEVVDFHDIGPTEEPVITEPFLSPDP
SLSPEVLDPLGQIQTQSMVTKSAETLDQDILQYLQI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcggagttcttgcgatctcaaatcttggggactacgttcgagactaccaacagatat
tctgacctccagcctgttggacttggtgcattcgggcttgtctgctcggcttatgacatg
attacgcgccagccagtagctatcaagaaaatgatgaagccgttctccaacgccaccctc
gccaaacgcacctaccgcgaagtgaagctcctgaaacacctgcgtcatgaaaatctgatt
ggcctgagcgacatttttatttcaccattagaggacgtttacctggtgacggatcttttg
gggactgacctgaaccgccttcttacctcaaagcctctggatggcaaatttgttcaatat
ttcacctatcagcttttgcgaggcctcaaatacatccactccgcaggcgtgatacaccga
gatctcaaaccgagcaacatactgatcaacgaaaactgtgacttgaagatctgtgacttt
ggtctagcgcgactgcaggagcctcagatgactggatatgtttcaaccagatattacagg
gcaccagaaatcatgttgacatggcaaaaatacggaatgcaggtggatatctggagtgct
ggctgcattgtcgcagagatgcttcgcggcaagccattgtttcctgggaaggatcatatc
aaccaattcttcctgatcacagatgctctggggaacccacccgacgaggtcattgagagg
atctgtacaaaaacaacccttgaccttgtgaaatcactgccaaagcgccagccagctcct
tgggcgacattgtttccagactctgatgaaaatgctattgatctccttggagagatgctc
atatttgatcccgacaagcggatctctgctgcgaaagccttggaacatccttacttgagc
gtatatcacgatcccactgatgagccggtcgctgaacaaatgttcgactggtctttcagt
gaagtggcgcattcaatcgatgagtggaaaatcatgatatacactgaagttgtagacttc
catgatattgggcctaccgaagaaccagtcatcacagagcccttcttgtctcccgatccg
agtctcagccctgaggtccttgacccgcttggccagatacaaacccaaagcatggtcact
aaatcagcggagaccttagaccaagatattctccagtacctccaaatttag

DBGET integrated database retrieval system