KEGG   Aspergillus niger: ANI_1_492104Help
Entry
ANI_1_492104      CDS       T01030                                 

Gene name
An12g03970
Definition
protein bimA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ang  Aspergillus niger
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ANI_1_492104 (An12g03970)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    ANI_1_492104 (An12g03970)
   04113 Meiosis - yeast
    ANI_1_492104 (An12g03970)
Protein phosphatases and associated proteins [BR:ang01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     ANI_1_492104 (An12g03970)
Ubiquitin system [BR:ang04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     ANI_1_492104 (An12g03970)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 809 aa AA seqDB search
MSPSTAHISSQLRQLIYYHLDNNLVRNALFLAGRLHAYEPRAAESSYLLALCHLQSGQVK
AAYDYSKNFGWRGTHLGCAYVFAQACLDLGKYPEGITALERSKGLWSTKNHWGKHSETRR
QHLPDAAAVLCLQGKLFYAHNELNAAVECYVDALKLNPFMWDAFLGLCETGVNIRVPNIF
KMTPELNALLASSSQDDLDLSSDKAAHSAGPLQSQPKLNSSTDPFTSLTSRTEAVGTHGS
SALWEKLNGSTVSVASTGTSAVPAFREGTETPGGQSSESDDRTMHRADAPLEPPLAPARK
NRTIQTISADHGMDSPPKMKPTGIRPRTRTKPEPDEPATTYTERELSQGVRVGDRKRTVS
GSVAHSAQQPTEPGAPQRRSVRLFNQIKPTTSKLSSSALGTKDGREMKKVRATGAKGRTT
TAPSVGRVVSGNRKHIGDTHDGETKDHRPATSASNGTHHTSSRGPSLDRSKAVEALTWLL
ELFSKLASGYFALCRYRCAEATQIFAALSQGQRETPWVLSQIGRAYYEQAMYSEAEKYFV
RVKSMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMETDRLSPQAWCAVGNSFSHQRDH
DQALKCFKRATQLDPHFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNAWYGLGT
VYDKMGKLEFAEQHFRNAANINPTNAVLICCIGLVLEKMNNPRGALAQYGRACQLAPHSV
LARFRKARVLMKLSELKLALTELKVLKDMAPDEANVHYLLGKLYKMLHEKANAIKHFTTA
LNLDPKAAQYIKDAMESLDDDEEDDEDMA
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccctccaccgcacatatatcgagccaacttaggcaattaatatactaccatctt
gataacaacctcgtccgtaatgcgcttttccttgccggtcggttgcacgcctacgaaccc
cgagcagcggaatcttcatatttactcgccttatgccatctccagagtggtcaagtgaaa
gcagcatacgactacagcaagaactttggatggcgaggcactcacctgggctgcgcatat
gtgttcgcccaggcgtgcctggacctgggaaaatatcctgaaggcatcacggcattggaa
cgaagcaaagggctctggtccacaaagaaccattggggaaaacacagcgagacgcgcagg
caacatttacccgatgcggcagcggtgctgtgtctacagggcaagctcttctatgcgcat
aatgaactgaatgcggctgttgaatgctatgtcgacgcgctcaagttgaacccgttcatg
tgggacgctttcttgggcttgtgtgagaccggggtcaatatccgcgtccccaacatcttc
aagatgacacctgaactgaacgctttgttagcgtcctcctcacaagatgacttagatttg
tcttcggataaggcagcacattctgcaggtcccttgcagtcacaaccgaaactgaactca
agcaccgatccctttacatctttgacgtctcggactgaggcagtcggcacccatgggagc
tccgctctctgggaaaagctcaatggcagcacggtcagcgtggcatccaccggcacatca
gcagttccggcatttcgagaagggaccgaaacacctggaggccaaagcagtgagtcggat
gaccgcaccatgcaccgggcagacgcgccattggagccgcccttggcgcctgcacggaag
aaccgaacgatacagacgattagtgccgatcacggcatggactccccaccaaagatgaag
cccacgggtatccgaccccgaaccagaaccaagcctgagcccgatgagccggccacaacg
tatacggaacgagaactctcacaaggagtccgtgtgggtgaccgcaagcgaactgtctct
ggatcagttgcccattctgcacagcaacccaccgaacctggcgcgccgcaacgacggagc
gtccgccttttcaaccagataaagcctactacgagcaagctttctagttccgcgctgggg
acgaaggatggccgagaaatgaagaaggtaagggctaccggtgcgaagggtcgaactaca
accgctcccagtgtgggtcgagtcgtcagcggcaatcgaaaacacatcggtgacacacat
gatggtgagaccaaggaccaccgcccagccacatcggcatcaaatgggacccaccacact
tcttcgagaggaccttcacttgatcggtctaaagctgtggaggcattgacatggctgtta
gagctattttcgaagctggcgtccggatactttgcgttgtgtcgctatcgttgcgctgaa
gctacccagatcttcgcagctttgtcgcagggccagagggagaccccatgggtactgtcg
caaatcggacgagcatactacgaacaggcgatgtattccgaagccgagaaatactttgtc
cgggtgaaaagcatggctccgtctcggctggaggatatggaaatctactcaaccgtgctc
tggcatttaaaaaatgatgtcgagctggcctatttggcgcacgagctcatggaaacagac
cgtctctcgcctcaggcctggtgcgctgttggcaactcattttcgcaccagcgggaccat
gaccaggctttgaaatgcttcaagcgagccacgcaacttgatcctcatttcgcatacggt
ttcactctgcaaggacatgaatatgtggccaatgaagagtacgacaaggctctcgatgcg
tatcgacacggaattagcgctgacagtcgccattataacgcctggtatgggttgggtacg
gtatacgacaagatgggcaagctcgagtttgccgaacagcatttccgcaatgcggctaac
atcaatccgacgaatgcggtgctcatctgctgcatcggactggtattggagaagatgaac
aacccccgcggggccctcgctcagtacgggcgggcctgtcaactggcacctcactcggtt
ctcgctcgcttccgcaaggctcgcgtactgatgaagctttcggagctgaagttggcgctg
accgagctgaaggtgcttaaggatatggcaccagatgaggccaacgtgcattatctgctg
ggtaaactctacaagatgttgcatgagaaggccaatgctatcaagcatttcacgaccgca
ttgaatttggatcccaaggcggcacaatacatcaaggatgccatggaatccctggacgat
gatgaagaggatgacgaagatatggcatga

DBGET integrated database retrieval system