KEGG   Aspergillus niger: ANI_1_544024Help
Entry
ANI_1_544024      CDS       T01030                                 

Gene name
An02g04000
Definition
[Pyruvate dehydrogenase [lipoamide]] kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     ANI_1_544024 (An02g04000)
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   ANI_1_544024 (An02g04000)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MWKPSESLMNTIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIINLPRPTLTQEVKTRLLRPGRLNGGTSRILS
ETTQNPSIREGQYRSSPSSLLNGNGNGKGAAVGRRYYAPSDDHGDWPPELNDYNERFAKT
LQHIKRRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALT
EQTHVRQPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFDAPKVQLVCKDDLNFMYV
PGHLSHMLFETLKNSLRAVVEAHGADKEAFPVTKVIIAEGKEDITIKISDEGGGIPRSAI
PLVWTYMYTTVEQTPSLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYG
TDVYLHLNRLSSSSEPLQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagccgtcggagagcctgatgaacaccatcagacattatgccagcttccctgca
actggtgtctctctccggcagatggtgcagtttggagatagaccctccacaggcaccctc
tttcgcgcctcacaattcctttccgaagaactcccaatacgcctcgctcatcgtgttcag
gatcttggagaacttccagatggactcagtgaaatgccatctatcaagaaggtccaggac
tggtacgcacagtcgttcgaggaaatcattaacctcccccgacctactctgacccaggaa
gtcaagactcgtctgcttcgtccggggaggctcaacggaggcacttcgaggatcctctcc
gaaacaacccagaaccctagcatccgtgaaggacaatatcggtcgtctccctcgtccctg
ttgaatggcaacggcaacggtaaaggcgccgccgtgggccgaagatactatgctccatct
gacgaccacggagattggccgccagaactgaatgattacaatgaacgcttcgccaagact
ttgcagcacatcaagcggagacacgacagtgttgtaactaccgtggctcaaggtattctt
gaatggaaacgaaagcgtcaacgtctgcagattgattccaccgtccagtccttcctcgat
cggttctacatgtctcggattggtatacgaatgttgattggtcaacacatcgccttaaca
gaacaaacgcatgtgcgacaaccaaactatgtcggtatcatttgtacgaaaaccaatgtg
cgcgaggtggccctcgaggctatcgacaacgctcgcttcgtttgtgaggattactatggc
ctgtttgatgctcccaaagtgcaacttgtctgcaaggacgatctgaacttcatgtatgtt
ccgggtcacttgtcccatatgctctttgaaaccttgaagaactccctgcgtgctgtcgtg
gaagcccacggcgcagacaaggaagccttcccggtcaccaaggtcatcatcgcagagggc
aaagaagacattaccatcaagatttccgatgaaggtggtggcatcccccgttccgccatc
cccttggtctggacgtatatgtacactaccgtagagcaaactcctagcctggatcccgat
tttgacaagagtgacttcaaggctcccatggctggctttgggtacggtctgccaattagc
cgactgtatgctcgctactttggtggcgatctgaagctgatcagtatggaagggtatggc
acggacgtctatctccatcttaaccgactctcttcgagctcggagcccctgcaatga

DBGET integrated database retrieval system