KEGG   Aspergillus niger: ANI_1_570164Help
Entry
ANI_1_570164      CDS       T01030                                 

Gene name
An18g04290
Definition
protein DFG10
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     ANI_1_570164 (An18g04290)
    1.3.1.94  polyprenol reductase
     ANI_1_570164 (An18g04290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 326 aa AA seqDB search
MELPFSLVDTALSSTHIDAIDALRAFFLLASCTILSVSILPDSLHSRFIPYGARTTSTAD
SQSSQSSPPASSDSSPAARALDYAAALTVPHSYFTQFYIASVLASVFWAAQLLCQGAVFQ
AFATRISPEHMQQSMSIHQVFLCWALMLIQGARRLYECKAFAKPSASRMWFVHWLVGLAF
YLAVSVALWIEGAGALLSHKVILDDLKVTIAPSLRTFVCIPLFLIASGIQHDCHHYLFSL
KKYTLPTHPIFRRIVCPHYTAECVIYLSLALLGAPKGEVVNKSLLSALVFVVINLGVTAA
NTRHWYMRKFGEESVRERSNMIPWVY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagctccccttcagcctggtggatacagctctttcctccacgcacattgacgccatc
gacgcccttcgagcctttttccttttggcatcctgcacgatactctccgtcagcatcctg
ccagattcgcttcattcacgcttcattccttatggcgctcgtacaacttcgacggccgac
tcgcagtcctcgcagtcctcgcccccggcgtcctcggactcctccccagccgcccgcgct
cttgactacgctgccgccttgacagtccctcacagctacttcacgcaattctacattgcc
tccgttttggcctcggtcttctgggctgcgcagcttctgtgtcaaggagccgtgttccag
gcctttgcaacgagaatcagtccggaacatatgcaacagtccatgtccatacaccaagtc
ttcttgtgctgggcgctcatgctcattcagggtgcaaggcggctatatgagtgcaaggcc
ttcgccaagccttcagcctcaagaatgtggtttgttcactggctcgtaggccttgcattt
tacctagcagtatccgttgccttatggatcgaaggagcaggagccctgctgtctcataaa
gtgattctcgacgacctcaaggttacaatagcaccctctctccgcacctttgtctgcatt
cctcttttcttgattgcatcaggcatccaacacgactgccaccattacctcttctctttg
aagaaatataccctgcccactcaccccatctttcgcaggatcgtatgtccacattatacg
gcagagtgtgtgatatatctttcgttggctctgctgggcgcgcccaagggcgaggtcgta
aacaagtcgttgttgtccgctctcgtatttgttgttatcaacttgggcgtcaccgctgcg
aacactaggcattggtatatgcgaaaattcggcgaggagtctgtgcgggaaagatcgaac
atgatcccttgggtttactaa

DBGET integrated database retrieval system