KEGG   Aspergillus niger: ANI_1_58074Help
Entry
ANI_1_58074       CDS       T01030                                 

Gene name
An08g00520
Definition
poly(A)+ RNA export protein
Orthology
K14298  
mRNA export factor
Organism
ang  Aspergillus niger
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ang00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ANI_1_58074 (An08g00520)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MSLFGSVGAATTSAGQTNTTGDISKDVALNQPPEDSISDLRFSPASEHLAVASWDKKVRI
YEINEQGQSEGKALFEHEAPVLSCCWSPDGTKVVGAGADKAARMLDLATNATTQVAAHDA
PIKCCHMIPNPAGGSPLLVTGSWDKTIKYWDLRQSNPIASVECQERVYTMDVKDKLLVVG
TADRYINVINLDQPTKFYKTMQSPLKWQTRVVSCFSTATGFAVGSVEGRCAIQYVEDKDS
SNNFSFKCHRETPQRDVNNIYSVNAISFHPVHGTFSTAGSDGTFHFWDKDAKHRLKGYPS
VGGTISSTAFNRNGNIFAYAVSYDWSKGYSANTQQLPNKVMLHPVSQEEVKPRPNNRKR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttttcggttccgtcggcgccgcgacgacctcagctggtcagaccaacaccaca
ggtgatatctccaaggatgtcgccctgaaccaacctcccgaggacagtatttcggacctc
cgcttctccccggctagtgaacacctcgctgtagcctcatgggacaagaaggttcgcatt
tacgagatcaatgagcagggccagagcgaaggtaaagctctgttcgagcacgaggccccc
gttctgagctgttgctggtcgccggatggtacgaaagtggtcggagctggcgccgacaaa
gccgctcggatgctcgaccttgcaaccaatgcgaccactcaagtcgccgctcacgatgcg
cccatcaaatgctgccacatgatcccaaacccggctggagggagcccgctactcgtaacc
ggttcttgggacaagaccatcaagtactgggacttgcgacagtcaaaccccatcgcctcg
gtggagtgccaggagcgtgtttacaccatggatgtcaaggacaaactcctcgtggtcggc
accgcagaccgctatatcaacgtcatcaacctcgaccaacccaccaaattctacaaaacc
atgcagtcccctctcaagtggcagacgcgggtagtcagctgcttttcgactgccaccggg
ttcgccgtcggcagtgtcgagggccgctgtgcgatccagtatgtcgaggacaaggactcc
tccaacaacttcagtttcaagtgccaccgtgagactcctcagcgcgatgtcaacaacatc
tactccgtcaacgccatctccttccaccctgtccacggcaccttcagcaccgccggcagt
gacggcaccttccacttctgggacaaggacgccaagcatcgtctaaagggatatccctcc
gtgggcggtaccatctccagcactgccttcaaccgcaacggcaacatcttcgcctacgct
gtcagttacgactggagcaaggggtactccgccaacacccagcaactgcccaacaaggtt
atgctgcaccctgtcagccaagaggaagtgaagcctagaccaaacaaccggaagaggtaa

DBGET integrated database retrieval system