KEGG   Aspergillus niger: ANI_1_598094Help
Entry
ANI_1_598094      CDS       T01030                                 

Gene name
An11g04380
Definition
ubiquitin hydrolase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ang  Aspergillus niger
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ang00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ANI_1_598094 (An11g04380)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ANI_1_598094 (An11g04380)
Peptidases [BR:ang01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ANI_1_598094 (An11g04380)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1101 aa AA seqDB search
MSPDAAALPSPPDFAPWENVPRRPQSLGGMQPGGKSIAAGLGSYQANNSYGSPAGSQPAR
FPNIKDLQDEAAALDLNDNTSLSVLLERAQVAIDRARELANTDQLDRAYVHYLRASEITI
NIIPNHPDYRATASQRPGWYKRFGELMMAVRMKQGTMDDIKQQILENNLLSNVQPGGVSR
SNPPRPRSEVISPGFGQSPGPRGRPVDAGNNSLRMPSPTQFQRSGEANAKMNRFSSPAGD
ALAERFAKLKMPPPPTPSDVGSISNGQNSTTSTPPTQEFPSRPSSQMSQGVPPRRPLGPR
SMGSSHSVPTIPPKVPLNTSLPRAPDPTYSPIWTVPSQGPSNPPRTSVESSRPVNPRYSQ
ITSSSRSSLSHDGFDDNPYRSQTPNGVHQAKEVRSSSADLPHSTTIEPQQLLEYMRKYNI
LLIDVRFRDQYDSGHIYASSILCIEPVALKENVSAEELEERLVVSPEHEQSLFERRNEYD
MVVYYDQGTASVSYLDGSPVGTTAPHLRALYDTLYEFNAYKPLKDGRPPALLLGGLDAWV
DLVGQQSLATSSTAAVMGSLQAKRPVRRPGRPLGRVPTIVSANSSLEVRKRRLREYKPLN
PQELTEWMEKSKTEEIDPGTYIEEEALTEEPEGAEEPPVSPFVHTYEDFLRRFPEPHAIQ
QSMVTAHVRPAGTPAPNYAAPVPVAPSRPPPAVPRPSYSGVSDGRQIQPTLERQYSATKT
ALYTPSSMLNRLKLPRTGLTNFGVTCYMNSTLQCLNATVVLSKFFIDNRFRYYVQKNWKG
SQGVMPGLFANLIRSLWKNDVEVIMPTSFRNFCGRLNQEWAIDRQQDAKEFFDFVVDCLH
EDLNINWQRTPLRPLTFEEEMQRERMPVPKVSKIEWDRYCHREESFISSLFAGQHASRLR
CTTCKRTSTTYEAFYSISVEIPPSGTGDIYQCLRSYCQEEMLSGDEVWKCPYCKCERVAT
KQIIITRAPQILVVHFKRFSASKTQSARKIHTPIDFPLHGLRMDDFVFSAYNQGQTNGLP
HDPIAATVPPFTYDAYGVLRHIGSSMGSGHYISLVRDAQRQCWRRFDDERVIDFNPRDLR
SKDRLQNEQAYIVFYERVPAK
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtccccagatgcagcggctctaccctctcctccagactttgcaccgtgggagaacgtt
ccccgccgccctcagtccctcggtggtatgcagccgggcgggaagtcaatcgccgccgga
ctaggatcgtatcaggccaacaacagctatgggtcccccgccggatctcaaccagctcgg
ttccccaatattaaggatcttcaggatgaagcagcagctcttgatctgaatgacaataca
tcgcttagcgttctgctggaacgagcgcaagtggccatagatcgagcccgtgagcttgcc
aacaccgatcagctggatagagcttatgtgcattacctgcgagcatccgagatcacgatc
aacataatacctaatcaccctgactaccgagccactgccagccaacgtccgggatggtac
aaacgattcggggagttgatgatggctgtgcggatgaagcaagggacaatggacgatatc
aagcaacaaatattggagaacaatttgctgagcaacgtgcagcctggcggagtgtctcgt
tcgaaccctccacgacctagatcagaggtaatatctcctgggtttgggcagagtccaggc
cccagaggtcgccccgttgacgctggcaacaactccctgcggatgcctagccctacgcag
ttccaacgatcaggtgaagcaaatgcgaagatgaatcgcttttcgagtcctgctggggat
gcacttgctgagagattcgcaaaactaaaaatgccgccgcctcctactccatctgatgta
gggtctatttccaatggccaaaacagtaccacctcaacacccccgactcaggagttccct
tctcgaccatcgtcccaaatgtctcaaggagtacctccgcggcggcctctagggccccgt
agtatgggctcctctcatagtgtgcctactattcctccgaaagtgccccttaatacatct
cttcctcgcgctcccgatccaacttacagtccgatctggacagtgccttcacaaggaccc
tcaaacccacccaggacctcagtcgaaagctctcgtcccgtcaacccacggtattctcag
attacatcatcatctcgcagtagtcttagccatgatggcttcgacgacaacccttacagg
tcgcaaaccccaaacggtgtacatcaggccaaggaagttagaagcagtagtgcagatctc
ccacacagcactacgattgagcctcagcagctgctggagtatatgcgcaaatacaacatt
ctattgattgacgtgcgttttcgggaccagtatgatagtggccacatctatgcctcttcg
atcctttgcattgagccagtggcactaaaggagaatgtgtcagcggaagaactcgaagaa
cgcttggtggtgtcgcctgaacatgagcagtcattattcgagcggcgcaacgaatatgac
atggtcgtctattatgaccagggaacggcatcggtcagctatctagacggatcccctgta
ggcaccacagctcctcatcttcgagcgctgtatgacacgctttacgagttcaacgcatac
aagccgctgaaagatggacgacctcccgccctactacttggcggccttgacgcatgggtc
gacctagtcggccagcagtctcttgctacatcctctactgctgctgtgatgggatccttg
caagcaaagaggcccgtcagacgaccggggcgaccgctaggaagagtgcctacgattgtc
agtgccaattctagtttggaagtgaggaagagaagattgcgcgaatacaagccgctgaat
cctcaagagcttacagaatggatggagaagtctaagacggaggaaatcgaccccgggacc
tatatcgaggaagaggcactcactgaagaaccggagggtgccgaagagccacctgtctct
ccctttgtgcacacatacgaggatttcctgcggcgcttcccggaaccacatgcgatccag
cagtcaatggtgacggcgcatgttcggcccgcggggacacccgctcccaattatgctgcc
cctgttcctgttgctccatcaaggcctccgcctgcagttccacggcccagttatagtggc
gtttcagacggccggcaaatacaacctaccttggagcgacagtactctgccaccaaaaca
gctctctacacaccaagctcgatgcttaaccgcctgaagctccccaggaccggcttaact
aactttggcgtgacttgttacatgaactctacccttcagtgtttgaacgctacggtggtg
ctgagcaagttcttcatcgacaatcggttccggtactatgtacaaaagaactggaagggc
tcccaaggcgtcatgccggggcttttcgcgaatctgatccgttcgctttggaagaacgac
gtggaagtaatcatgccgacttcctttcgaaacttctgcggacgattaaaccaagaatgg
gctatcgatcgccagcaggatgccaaagagttctttgactttgtcgtcgattgtctgcac
gaggacctcaacatcaactggcagcggacgcctctcagacccttgacattcgaggaggag
atgcagcgcgagagaatgcctgttcccaaggtttctaaaattgagtgggatcgatactgt
catcgcgaagagtcgttcatttcctcgctctttgcaggccagcacgcgagccggctacgc
tgcaccacctgcaagcggacatcaaccacgtatgaggcgttctatagcatcagtgtggag
attccaccgtcgggcacgggcgacatatatcaatgccttcgcagttattgtcaagaggag
atgttgagtggggatgaggtgtggaaatgtccgtactgcaagtgcgaacgagtggccacc
aaacagatcatcatcacgcgggcgccgcagatcttggtcgtccacttcaagcggttctcg
gcgtcgaagacccagtctgcacgaaagatccatacgcctatcgacttccctttgcacgga
cttcggatggatgattttgtcttctcggcatacaatcaggggcagaccaacggattgccc
cacgacccgatcgcagccactgtgcctccgttcacgtacgatgcgtacggggtgctacgg
catatcgggtcgtcgatgggcagcggacattacatctctctggtgcgagatgcgcagcgg
caatgctggcgacggttcgacgacgagcgggtgatcgatttcaacccgcgcgatctgcga
tcgaaagatcggctgcagaacgaacaagcctatattgtattctacgagcgggtgcccgcc
aagtaa

DBGET integrated database retrieval system