KEGG   Aspergillus niger: ANI_1_598094Help
Entry
ANI_1_598094      CDS       T01030                                 

Gene name
An11g04380
Definition
ubiquitin hydrolase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ang  Aspergillus niger
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ang04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1101 aa AA seqDB search
MSPDAAALPSPPDFAPWENVPRRPQSLGGMQPGGKSIAAGLGSYQANNSYGSPAGSQPAR
FPNIKDLQDEAAALDLNDNTSLSVLLERAQVAIDRARELANTDQLDRAYVHYLRASEITI
NIIPNHPDYRATASQRPGWYKRFGELMMAVRMKQGTMDDIKQQILENNLLSNVQPGGVSR
SNPPRPRSEVISPGFGQSPGPRGRPVDAGNNSLRMPSPTQFQRSGEANAKMNRFSSPAGD
ALAERFAKLKMPPPPTPSDVGSISNGQNSTTSTPPTQEFPSRPSSQMSQGVPPRRPLGPR
SMGSSHSVPTIPPKVPLNTSLPRAPDPTYSPIWTVPSQGPSNPPRTSVESSRPVNPRYSQ
ITSSSRSSLSHDGFDDNPYRSQTPNGVHQAKEVRSSSADLPHSTTIEPQQLLEYMRKYNI
LLIDVRFRDQYDSGHIYASSILCIEPVALKENVSAEELEERLVVSPEHEQSLFERRNEYD
MVVYYDQGTASVSYLDGSPVGTTAPHLRALYDTLYEFNAYKPLKDGRPPALLLGGLDAWV
DLVGQQSLATSSTAAVMGSLQAKRPVRRPGRPLGRVPTIVSANSSLEVRKRRLREYKPLN
PQELTEWMEKSKTEEIDPGTYIEEEALTEEPEGAEEPPVSPFVHTYEDFLRRFPEPHAIQ
QSMVTAHVRPAGTPAPNYAAPVPVAPSRPPPAVPRPSYSGVSDGRQIQPTLERQYSATKT
ALYTPSSMLNRLKLPRTGLTNFGVTCYMNSTLQCLNATVVLSKFFIDNRFRYYVQKNWKG
SQGVMPGLFANLIRSLWKNDVEVIMPTSFRNFCGRLNQEWAIDRQQDAKEFFDFVVDCLH
EDLNINWQRTPLRPLTFEEEMQRERMPVPKVSKIEWDRYCHREESFISSLFAGQHASRLR
CTTCKRTSTTYEAFYSISVEIPPSGTGDIYQCLRSYCQEEMLSGDEVWKCPYCKCERVAT
KQIIITRAPQILVVHFKRFSASKTQSARKIHTPIDFPLHGLRMDDFVFSAYNQGQTNGLP
HDPIAATVPPFTYDAYGVLRHIGSSMGSGHYISLVRDAQRQCWRRFDDERVIDFNPRDLR
SKDRLQNEQAYIVFYERVPAK
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgtccccagatgcagcggctctaccctctcctccagactttgcaccgtgggagaacgtt
ccccgccgccctcagtccctcggtggtatgcagccgggcgggaagtcaatcgccgccgga
ctaggatcgtatcaggccaacaacagctatgggtcccccgccggatctcaaccagctcgg
ttccccaatattaaggatcttcaggatgaagcagcagctcttgatctgaatgacaataca
tcgcttagcgttctgctggaacgagcgcaagtggccatagatcgagcccgtgagcttgcc
aacaccgatcagctggatagagcttatgtgcattacctgcgagcatccgagatcacgatc
aacataatacctaatcaccctgactaccgagccactgccagccaacgtccgggatggtac
aaacgattcggggagttgatgatggctgtgcggatgaagcaagggacaatggacgatatc
aagcaacaaatattggagaacaatttgctgagcaacgtgcagcctggcggagtgtctcgt
tcgaaccctccacgacctagatcagaggtaatatctcctgggtttgggcagagtccaggc
cccagaggtcgccccgttgacgctggcaacaactccctgcggatgcctagccctacgcag
ttccaacgatcaggtgaagcaaatgcgaagatgaatcgcttttcgagtcctgctggggat
gcacttgctgagagattcgcaaaactaaaaatgccgccgcctcctactccatctgatgta
gggtctatttccaatggccaaaacagtaccacctcaacacccccgactcaggagttccct
tctcgaccatcgtcccaaatgtctcaaggagtacctccgcggcggcctctagggccccgt
agtatgggctcctctcatagtgtgcctactattcctccgaaagtgccccttaatacatct
cttcctcgcgctcccgatccaacttacagtccgatctggacagtgccttcacaaggaccc
tcaaacccacccaggacctcagtcgaaagctctcgtcccgtcaacccacggtattctcag
attacatcatcatctcgcagtagtcttagccatgatggcttcgacgacaacccttacagg
tcgcaaaccccaaacggtgtacatcaggccaaggaagttagaagcagtagtgcagatctc
ccacacagcactacgattgagcctcagcagctgctggagtatatgcgcaaatacaacatt
ctattgattgacgtgcgttttcgggaccagtatgatagtggccacatctatgcctcttcg
atcctttgcattgagccagtggcactaaaggagaatgtgtcagcggaagaactcgaagaa
cgcttggtggtgtcgcctgaacatgagcagtcattattcgagcggcgcaacgaatatgac
atggtcgtctattatgaccagggaacggcatcggtcagctatctagacggatcccctgta
ggcaccacagctcctcatcttcgagcgctgtatgacacgctttacgagttcaacgcatac
aagccgctgaaagatggacgacctcccgccctactacttggcggccttgacgcatgggtc
gacctagtcggccagcagtctcttgctacatcctctactgctgctgtgatgggatccttg
caagcaaagaggcccgtcagacgaccggggcgaccgctaggaagagtgcctacgattgtc
agtgccaattctagtttggaagtgaggaagagaagattgcgcgaatacaagccgctgaat
cctcaagagcttacagaatggatggagaagtctaagacggaggaaatcgaccccgggacc
tatatcgaggaagaggcactcactgaagaaccggagggtgccgaagagccacctgtctct
ccctttgtgcacacatacgaggatttcctgcggcgcttcccggaaccacatgcgatccag
cagtcaatggtgacggcgcatgttcggcccgcggggacacccgctcccaattatgctgcc
cctgttcctgttgctccatcaaggcctccgcctgcagttccacggcccagttatagtggc
gtttcagacggccggcaaatacaacctaccttggagcgacagtactctgccaccaaaaca
gctctctacacaccaagctcgatgcttaaccgcctgaagctccccaggaccggcttaact
aactttggcgtgacttgttacatgaactctacccttcagtgtttgaacgctacggtggtg
ctgagcaagttcttcatcgacaatcggttccggtactatgtacaaaagaactggaagggc
tcccaaggcgtcatgccggggcttttcgcgaatctgatccgttcgctttggaagaacgac
gtggaagtaatcatgccgacttcctttcgaaacttctgcggacgattaaaccaagaatgg
gctatcgatcgccagcaggatgccaaagagttctttgactttgtcgtcgattgtctgcac
gaggacctcaacatcaactggcagcggacgcctctcagacccttgacattcgaggaggag
atgcagcgcgagagaatgcctgttcccaaggtttctaaaattgagtgggatcgatactgt
catcgcgaagagtcgttcatttcctcgctctttgcaggccagcacgcgagccggctacgc
tgcaccacctgcaagcggacatcaaccacgtatgaggcgttctatagcatcagtgtggag
attccaccgtcgggcacgggcgacatatatcaatgccttcgcagttattgtcaagaggag
atgttgagtggggatgaggtgtggaaatgtccgtactgcaagtgcgaacgagtggccacc
aaacagatcatcatcacgcgggcgccgcagatcttggtcgtccacttcaagcggttctcg
gcgtcgaagacccagtctgcacgaaagatccatacgcctatcgacttccctttgcacgga
cttcggatggatgattttgtcttctcggcatacaatcaggggcagaccaacggattgccc
cacgacccgatcgcagccactgtgcctccgttcacgtacgatgcgtacggggtgctacgg
catatcgggtcgtcgatgggcagcggacattacatctctctggtgcgagatgcgcagcgg
caatgctggcgacggttcgacgacgagcgggtgatcgatttcaacccgcgcgatctgcga
tcgaaagatcggctgcagaacgaacaagcctatattgtattctacgagcgggtgcccgcc
aagtaa

DBGET integrated database retrieval system