KEGG   Aspergillus niger: ANI_1_602124Help
Entry
ANI_1_602124      CDS       T01030                                 

Gene name
An14g04190
Definition
1,4-alpha-glucan-branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ang  Aspergillus niger
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ANI_1_602124 (An14g04190)
Enzymes [BR:ang01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ANI_1_602124 (An14g04190)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_602124 (An14g04190)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 692 aa AA seqDB search
MASTETQTALQSAPPDGTGVIQLDPWLEPFRDALKQRFQFVESWVKTINETEGGLDKFSR
GYERYGINVNANGDITYREWAPNAVEAELVGDFNNWDVTAHPMTKNSFGVWEITLPAKDG
VPVIPHDSKIKITMVTPEGERIYRIPAWIKRVVQDLTVSPTYESVFWNPPATERYQFKHS
RPKRPESLRIYEAHVGISSPETRVATYKEFTANMLPRIKYLGYNAIQLMAIMEHAYYASF
GYQVNSFFAASSRYGTPEDLKELVDTAHSMGLVVLLDVVHSHASKNVLDGLNMFDGSDHL
YFHSGGKGQHELWDSRLFNYGSHEVLRFLLSNLRFWMEEYKFDGFRFDGVTSMLYTHHGI
GTGFSGGYHEYFGGSVDGEGVMYLTLANEMLHSLYPDCITVAEDVSGMPALCLPHALGGV
GFDYRLAMAIPDMYIKLLKEKSDDEWDIGNLSFTLVNRRHGEKTIAYAESHDQALVGDKT
IMMWLCDKEMYTHMSVLTEFTPIIERGMALHKMLRLVTHGLGGEGYLNFEGNEFGHPEWL
DFPRAGNNNSFWYARRQLNLTEDHLLRYKFLNDFDRAMQLTEEKYGWLHSPQAYISLKHE
GDKVLVFERAGLLWIFNFHPSNSFTDYRVGVEQAGTYRIVLDTDDKEFGGFGRNLKETRF
FTTDLPWNGRSNYLQVYLPTRTALVLALEETL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaccgaaactcaaactgcccttcaatcggcgcctccagatggtacaggcgtt
atccagcttgatccttggcttgagcccttccgggatgctctgaagcagagattccagttc
gtagagagctgggtcaagacgattaatgaaactgagggcgggttggacaagtttagcagg
ggctacgagagatacggtatcaatgtcaacgccaatggggacatcacttacagagaatgg
gcacccaatgctgtcgaggctgagctagttggggattttaacaattgggatgtcacggcc
cacccgatgacgaagaatagcttcggtgtctgggagatcacattgccagcaaaggatggg
gtcccggtgatccctcatgacagcaaaatcaagataactatggtcactcccgaaggagaa
cgaatctaccgaatccctgcatggatcaagcgtgtcgtgcaagaccttactgtgtctccg
acatatgagtcggttttctggaaccctccagcaaccgagcggtatcaattcaaacattct
cgcccaaagaggcccgaaagccttcgtatctatgaggcccacgtgggtatttcttctccg
gaaacgagagtcgcaacttacaaagaattcactgcaaatatgctacctcgcatcaagtat
ctggggtacaacgcaatccagcttatggccatcatggagcatgcctactacgccagcttc
gggtaccaggtcaatagcttcttcgcggccagcagtcgctatggtacgccggaagacctg
aaagagctagtagatacagcacatagcatgggcttggtggtgcttcttgacgtcgtccac
agtcatgcgtccaaaaatgtcctggacgggctgaacatgtttgatggctctgaccatctc
tactttcactccgggggaaagggtcagcatgaactctgggacagtcgtctgttcaactac
ggaagccatgaagtcctgaggttcctcctgagcaatctccgcttctggatggaagaatat
aagtttgacggtttccgtttcgatggtgttacaagtatgctttatacccatcacgggata
ggaactggtttctctggcggatatcacgagtactttggtggttcggtagatggcgagggt
gtgatgtacctgaccttggccaacgaaatgctccacagtctatatcccgactgtataact
gtggcagaagatgtatctggaatgccagcactgtgcttgccgcacgcccttggaggtgtt
ggatttgactaccgacttgccatggcaattccagacatgtacatcaagctcttgaaggag
aagtcggacgatgaatgggacattggcaacctctctttcacgttggtcaaccgacgtcac
ggggaaaagacgatcgcctacgcggagagtcatgatcaggcacttgttggcgacaaaacc
atcatgatgtggctttgtgacaaggagatgtacacccacatgtccgtgttgacagagttc
acccccattattgaaagaggcatggctctacacaagatgctccgcctagttacacatgga
ctcggtggtgagggttatctcaacttcgaaggtaacgaattcggtcatcccgaatggctc
gacttccctcgtgccggtaataacaactcattctggtacgcacgtcgccaactgaaccta
acggaagaccacctccttcgctacaaattcctgaacgacttcgaccgcgccatgcaatta
accgaagagaaatacggctggcttcattccccacaagcatacatcagcctgaagcacgag
ggtgacaaggtccttgtctttgaacgtgcaggcctcctctggatctttaactttcatccc
tcaaacagcttcacggactacagagtgggcgtcgagcaagccggaacctacagaatcgta
cttgacaccgatgacaaggagtttggtggtttcggtcgcaatctcaaggagacgcgcttc
ttcactacagacctgccctggaatgggcgcagcaattatctacaggtctatcttcctacg
cgaacagcattggttcttgccttggaagagaccctatag

DBGET integrated database retrieval system