KEGG   Aspergillus niger: ANI_1_6054Help
Entry
ANI_1_6054        CDS       T01030                                 

Gene name
An06g00170
Definition
alpha-galactosidase A
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ang  Aspergillus niger
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:ang00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ANI_1_6054 (An06g00170)
  Lipid metabolism
   00561 Glycerolipid metabolism
    ANI_1_6054 (An06g00170)
   00600 Sphingolipid metabolism
    ANI_1_6054 (An06g00170)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    ANI_1_6054 (An06g00170)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ANI_1_6054 (An06g00170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MNQGTKSILLAATLAAIPWQVYGSIEQSSLLPIPPMGFNNWARFMCDLNETLFTETADAM
AANGLRDAGYNRINLDDCWMAYQRSDNGSLQWNTTKFPHGLPWLAQYVKAKGFHFGIYED
SGNMTCGGYPGSYNHEEQDANTFALWGIDYLKLDGCNVYATQGRTLEEEYKQRYGHWHQV
LSKMQHPLIFSESAPAYFAGTDNNTDWYTVMDWVPIYGELARHSTDILVYSGAGSAWDSI
MNNYNYNTLLARYQRPGYFNDPDFLIPDHPGLTADEKRSHFALWASFSAPLIISAYIPAL
SKDEIAFLTNEALIAVNQDPLAQQATFASRDNTLDILTRNLANGDRLLTVLNKGNTTVTR
DIPVQWLGLTETDCTYTAEDLWDGKTQKISDHIKIELASHATAVFRLGLPQGCSSVVPTG
LVFNTASGNCLTAASNSSVAFQSCNGETSQIWQVTLSGVIRPVSQTTQCLAADGNSVKLQ
ACDSTDSDGQNWTYAVTGNLKNAKTDGCLTEGSVQMKSCLYERDGQVFGLPSGVQLS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaggaaccaagagtatactactggctgccacgctagcagccatcccctggcaa
gtctacggctccatcgagcagtccagcctcctgccaataccacccatgggtttcaacaat
tgggcccgcttcatgtgcgacctcaacgagaccctgtttaccgagactgccgatgcgatg
gctgctaacggtctgcgggacgcaggctacaatcgcatcaatctggatgattgctggatg
gcttatcagcgatccgacaatggatccctacagtggaacacgactaagttcccacacggc
ctgccttggctagctcaatatgtcaaagccaaagggtttcattttggaatctatgaagat
tctggcaacatgacttgtggcggataccccggatcctacaaccacgaggagcaggacgcc
aacacctttgctttatgggggattgactatctcaagctcgacggttgcaatgtctacgca
acacaaggtaggacactcgaggaggaatacaagcaacgctacggacattggcaccaagtc
ctcagcaagatgcagcacccactgatcttctccgagtcagccccggcatacttcgcgggc
acagacaacaacacagactggtacaccgtgatggactgggtcccgatctacggggagctg
gcccgccattctaccgatatcctggtgtacagtggagcaggtagcgcatgggacagcatt
atgaataactacaactacaacactcttcttgcgcgctaccagcgaccggggtatttcaat
gatcctgattttctgatcccggatcatcctggcctgacggcggatgaaaagcgatcgcat
tttgcactgtgggcttctttctcggctccacttattatcagtgcttatatacctgcactt
tcgaaggatgagattgccttcttgacgaacgaggcattgattgcggtgaatcaggatccc
ctggcgcagcaggccacgtttgcgagccgcgataacacactggatatattgacgcgtaat
ctggcaaacggcgacaggctgctgacggtgcttaataagggaaacacaactgtaacgagg
gacattcccgtacaatggttgggtcttacagagactgactgtacatacacggccgaggat
ctctgggatggcaagacccagaagatcagcgaccatataaagattgaactagccagccat
gcgacagcagtcttccggctcggtcttccgcagggttgttcctcggtagtgccaacggga
cttgtcttcaacacagcatcgggcaattgtctgaccgctgcctcaaattcttcagtcgca
tttcagtcctgcaatggagagacctctcagatctggcaggtgacactgtcaggagtcatt
cgtccagtatcgcagaccacacaatgcttggctgctgatggaaactcagttaagctgcaa
gcatgtgacagcacggatagcgacggccagaactggacgtatgcagtcacgggaaattta
aagaatgcgaagacagatggttgcctgactgagggatcagtgcagatgaagtcgtgtctt
tatgagagggatggccaggtatttggtctcccaagtggcgttcagttgtcgtag

DBGET integrated database retrieval system