KEGG   Aspergillus niger: ANI_1_608084Help
Entry
ANI_1_608084      CDS       T01030                                 

Gene name
An09g04950
Definition
asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ANI_1_608084 (An09g04950)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     ANI_1_608084 (An09g04950)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     ANI_1_608084 (An09g04950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 563 aa AA seqDB search
MAALDVNGPLPELSEQQPDDLIPESRVLIIMTGGTICMRQSPSGFIPARGFQEQCLARVP
TFNDGSHPSMMDVVINSDGEIKGHPALRTPQTAYGRRVRYTVFEFEELLDSSSIDAKGWA
QIAHTVERNYTLFDGFVVLHGTDSLAYTCSALSFMLQNLGKPVILTGAQAPMLELQNDAT
DNLLGSLVVASHFMIPEVCLYFNNRLFRGNRSIKVAASDFAAFDSPNCPPLAVTTSMRTN
VNWELVNRPKSLEHFRIQTNLDTTHVACLRIFPGIKPEMVDAVLKLEGLRGLVLETFGAG
NAPSGQDNAMTNVLAAAIKRGIVIVNVTQCLTGSVSPVYAPGMSLSRAGVVAGLDLTTEA
ALTKMSYLLALPDSTPEWVAKKMSVSLRGELTEVSQPVFRHPDGALPERVQSLTVLGYAI
AQGDLERVEEIVAREHQWLLNDADYSGNTPIHLAATSPSIEILRYLLLQGGSVHLRNRNG
RTPLFLAANAGFSEHVLLLRKSGAHLHSDERTAAQLLARRRPGVWGLAGIGPREVSEREM
EELEDSSVSIGRMAQRVMAGSAP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcagctctcgatgtcaatggtcccttgcccgagctgtctgagcagcagccggacgat
ctcatccccgagtcccgggtcctcattatcatgactggtggtacaatctgtatgcgacag
tccccgtcaggcttcattcctgccagaggtttccaggagcaatgtctggcccgggtgccg
acattcaacgatggttcgcacccgagcatgatggatgttgtgatcaactcagacggagag
atcaaaggacatcccgctctccgcacaccacagacagcctatgggcgacgggtgcggtac
actgtcttcgagttcgaagagctcctcgatagcagttctatcgatgcgaaaggttgggcc
cagatcgcccacaccgttgaacgaaactacacacttttcgatggcttcgtcgtcctccac
ggaacagacagtctcgcatacacatgctcagcgcttagcttcatgctgcagaatctcgga
aagcccgtgattctcactggagcacaggcgcccatgctggaattgcagaatgatgccacc
gataaccttctcggatcactggtcgtggctagccatttcatgattcccgaagtgtgcctg
tacttcaacaaccgactgttccgtggcaaccggtcgatcaaggtcgcggccagtgatttc
gctgccttcgactctccgaattgccccccgctggcggtgacaacctccatgcggaccaac
gtgaactgggagctggtcaaccgaccgaagagcctcgaacatttccgtatccagaccaac
ctcgacaccacccacgtggcgtgtcttcgtatcttccctggtatcaagccggagatggtc
gacgccgtgctgaagctggaaggacttcgtggtttagtgttggagacgtttggcgccggt
aacgcaccgagtggtcaagacaatgccatgaccaatgtgttggccgccgctatcaagaga
ggaatcgtgatcgtgaatgtcacgcaatgtctgacgggaagtgtcagcccagtctatgcc
ccaggcatgagtctctctcgcgccggagtcgtcgcaggactcgacctgaccaccgaagct
gcactgaccaagatgtcgtatcttctcgctcttcccgattccaccccagaatgggtagcc
aagaaaatgtcagtatctcttcgcggcgaattgaccgaggtatcgcagccagtcttccgc
cacccggacggggcgctcccagagcgcgttcagtccctcacggtgctcgggtacgccatc
gcgcagggtgatctcgagcgcgtggaggagattgtggcccgagaacaccaatggttattg
aatgacgccgattattcgggcaacacacctatccacctcgcagcgacatctccctcaatt
gagattctccgatacctgttgctccagggtggctccgtgcacttgcgaaaccgcaatggt
cggacgccgctgttcctggcggccaacgcaggattctcggagcacgtgctgctgctacgc
aagtctggagcgcatctgcactctgacgaacgcacggcggcgcagttgttggcccggcgc
cgacctggcgtctgggggttggcggggattgggccgcgcgaggtgagtgagcgcgagatg
gaggaactggaggactcgagtgtgtctataggacgtatggcgcagcgagtgatggcggga
tcggcaccttga

DBGET integrated database retrieval system