KEGG   Aspergillus niger: ANI_1_614034Help
Entry
ANI_1_614034      CDS       T01030                                 

Gene name
An03g04960
Definition
protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ang  Aspergillus niger
Brite
Enzymes [BR:ang01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     ANI_1_614034 (An03g04960)
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   ANI_1_614034 (An03g04960)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1431 aa AA seqDB search
MSENLAFQQTPGKGQSRRVQSRPSSPSRIDDTSSAADGPTRRRLQKHASTPFLSDTSSHS
PKTAAGTRTGVMSKRRLSIRDQKVPQGPRPQDPSRTSNMSGSFFHSGHSSIDSTNDSTQS
NNSRISLRSTSISNFSKIEYNKQTPPDSTEFLAPVNFDDLQNSITEPNLSHFPTPGQAGA
GYETRLPNNSNDNGTTTRSRSNSVRRKSLVNGSIDPGSARAPASATAARSRRQSLAQPTA
STTTTSRAPRKSIGPGSLAATGTGRRQSLSARKASADTTRMEQGNLLRPRTQHFEPARQQ
DGTKLSGNSRSIKAKSLQPPLREPQEIYLTASGPAEHSRSCSTNAVRTPVKNAAAPMATP
SSSSKRVSVMPPHATGLGARTISPTDARRIKRMSTVPSAQQAPFTPPTQTEPVPTRPRST
AQSPSHIPRKSVTPSSTRTTPDPNRKSYSSGLSLSSNTSYNSARNSGGSLQTRLSQSSST
SRLPTPKPRMEHAVADEEVPPVPAIPKAYESPKGDFDPPNYVTPRKPSLYLDVEPTAKAE
QDSDTNQTASATEDDTLGANDERALKTPDAKTKPSAGLAKKSLQPLKLPPLNLLPLGTPM
TTKIEALKDRDDDVKSYTPSAQTLSKTPSTPLTASKANFFSPQDNEDAVPLTQARSSTSH
FALSTSSGSAALRTASSSSALAAFDNISAGTRTVSPYVAYSLPKSTSDYTALRPKATEDC
SPKVTQSHKLTGPRPQTRSSAFSSNAETISQLSTPSDPDNNSVSGSSLRSKITFTRNRSS
SKPQQGLESNGDPIKLEKMPPPKLPASATWSNMSTTSTSSPSLKPSYFKSRRQASMSTAT
NQPMRNPSFSSDQSLALEPSPSNESGDSDVVAHRSAASILSPVHKIISSAKSSVGATSVP
TESNVDADIRVADEEMRRLGSKRKDFETAARNLDDLRRKASPKERVSPAQALRVASLNIF
ERGEIIDFKDIYFCGTQNAKKHVGDLTAQANFGYDDDRGDYNIVIGDHLAYRYEVIDVLG
KGSFGQVVRCIDHKTGGLVAVKIIRNKKRFHQQALIEVNLLQKLKEWDPHRKHSVVNFTQ
SFYFRGHLCISTELLGMNLYEFIKAHDFKGFSLKLIRRFTKQMLGTLVLLHNKKVIHCDL
KPENILLVHPMSSEIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSVG
CILAELFTGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRKKLFFDSLGKPRLTVSSK
GRRRRPSSKELKQVLKCDDEAFLDFISRCLRWDPSRRMSPQDALRHEFITGVKMPSRART
YTLTTQSPAKRATTSSHPSAGRPLPEPPVTSLKSGTLIRNRDASGTSPVKLPAGKRHSTV
SGLPPSTPAKRGTSISTTSTPGSALPRVAARSISGKPDLATAAAATSLRTK
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaatctagctttccagcaaactccaggaaaggggcaatcgcgcagggtacaa
tcaagaccatctagcccatctcgtatcgatgatacaagctcagcagcagacggtcctacg
cgcagacgattgcaaaaacacgcctcaaccccgttcctgtcagatacttcctctcattcc
cctaaaaccgctgctgggacccgaactggcgtgatgagcaagaggagactctcaattcga
gaccagaaagtgccacagggcccgcgaccgcaggatccctcacgaacaagcaacatgtct
ggttccttcttccattccggtcactcttcgattgattccacaaacgattcgacgcagagc
aacaactcccgcatcagcctccgatctaccagcataagtaacttctcaaaaatcgaatac
aataaacaaacccctcctgatagcaccgaattcctcgcccccgtcaatttcgatgatctc
cagaacagcataacagagcctaacctcagtcactttcccactcctggacaggcgggagct
gggtatgaaacaaggcttccgaacaacagtaacgataatggcacgaccactaggtcaaga
agcaattccgttcggcggaagagcctggtcaacggttctatcgacccaggatcggctcgg
gctccagcttcagccacggctgcccgaagccgtcgccagagcctagctcagcctacagcc
tcgaccacaactacttcgcgcgctcctcggaagtccatcggccctggctctctcgcggca
actgggaccggcagacggcaaagcctgtcagcacgaaaagctagtgcagacacaacacgg
atggaacaaggcaaccttctgcgtccgagaacacagcatttcgaaccggcccgacaacag
gatggcacgaaactctctggcaattcccggagcatcaaggccaagtcgctgcaaccgcca
ttgagggaaccccaagagatctacctgacagcatctggccctgcagagcattctcgttct
tgttcgaccaatgctgttcgaaccccagtcaagaacgcggcagctcccatggcaactccg
tcgtcttcatccaaaagggtttcggttatgccgccacatgctactggcctgggggcgcgg
acaataagccccactgatgcgcgacgaatcaagcgtatgtctacggtgccatcggcgcaa
caggcaccgtttacccctccgactcagacagagcctgtgcctactcgtcctcggtccact
gcacagtctccttcgcatattccgcgaaagagcgtgaccccctcgtctactcgtactacg
cctgacccaaatcggaaatcctatagctctggcttgtctctgtcatcgaacaccagctac
aactccgcaaggaattcgggcggttcattacagaccaggctatcccagtcttcatccacg
tcacgtctgcccacccctaagcctcgtatggaacatgcggtggccgatgaggaggttccg
cctgtccctgcaattccaaaggcgtacgagtcacccaaaggcgattttgacccaccgaat
tatgttaccccccgaaagccaagtctatacttggacgtcgagcccacggctaaagcagaa
caagactctgacacaaatcaaacagcgagtgcgaccgaagatgatacacttggagccaat
gatgagcgagctttgaaaacaccggatgcgaaaactaaaccatccgccgggctggcgaaa
aagagtttacagcccttaaagttaccgccgttgaatttacttcctctgggtaccccaatg
acgacgaagatcgaggcgttgaaggaccgggatgatgacgtcaaatcctacacgccttca
gcacagactctgtctaaaacccccagtactccgttaaccgcctccaaggcaaatttcttc
tcacctcaggacaatgaggatgcagtgccacttacccaggctagaagtagcacgtcgcat
ttcgccttgagtacatcgtcaggtagtgcggctcttcggacggccagcagttctagtgcg
ctggcggctttcgacaatatttctgctggtacaagaaccgtttcgccatatgttgcgtac
agcttgccgaaaagcactagcgactatactgctctgcgccctaaagctaccgaagattgc
tctcccaaggtgacgcagtctcacaagctcactgggcctcgtccccaaacacgatcatct
gccttctcctccaatgccgagactatcagtcagctttcgactccttctgaccccgacaac
aacagcgtgtcgggctcctccctccgcagtaagatcacgttcactcggaaccgcagcagt
tccaagccccaacaggggctcgagtcaaatggcgaccctataaaactcgagaagatgccc
ccaccgaagctcccagcctctgcaacttggagtaatatgtcaacaacgagtacctctagc
ccgtcgctcaagccgtcctatttcaaatcacggcgacaagcatcgatgtctaccgctacc
aaccagccgatgaggaaccctagcttcagcagcgaccaaagccttgcgctggagccaagt
ccttccaatgagtcaggcgatagtgatgtggtagcgcaccggtcagcagcatcgatctta
tcgcctgtacacaaaattattagctcggccaagtcgagtgtcggggcaacatcagttccc
acggagtccaatgtagacgccgatatacgcgtggctgatgaagaaatgcgacggcttggc
agcaagcgtaaagattttgagaccgcggctaggaatctggatgacttgcgccggaaagcc
agtcccaaggagcgtgtcagtccggcacaggctctgcgggtcgccagtctgaacatcttc
gagcgtggggagatcatcgacttcaaggacatctacttttgcgggacccagaatgcgaaa
aagcatgttggtgatctgactgctcaagcaaactttggctacgatgacgaccgtggtgac
tataatattgtgattggagaccatctggcctaccgatacgaggttatcgatgtactcggc
aagggaagtttcggtcaagtggtgagatgcatcgatcacaagacaggtggcctggttgcc
gtgaagattatccgcaataagaagaggttccatcagcaagcattgattgaggtcaatctt
ctccagaagctgaaggaatgggacccccatcgtaaacatagcgttgtgaacttcacccaa
agcttttacttccgcggccatctctgcatctcgactgagctgctcggcatgaatctctac
gaattcatcaaggcacacgactttaagggattctctcttaaacttattcgtcgctttaca
aagcagatgctgggtacactggtgcttctacacaataagaaggtcattcactgtgatctc
aagccagaaaacatcctcctcgtgcatccaatgagctctgagatccgagtcatcgatttt
gggtccagctgctttgaaaacgagaaggtgtacacttatattcagagtcgattctaccgt
tctccggaagtcattctcggcatgtcgtatggtatgcccatcgatatgtggagtgtggga
tgtattctggcggagcttttcaccggataccccatcttccccggagaaaacgaacaggag
cagcttgcttgcatcatggaggtatttggacctccagagaagcacttgatcgaaaagagc
actcggaagaaactcttctttgactcgctgggcaagccgagacttacagtctcctccaag
ggccgacggcgtcgtcccagctccaaggagctcaagcaggttctcaaatgtgatgacgag
gcattcctcgacttcatttcccgttgccttcgatgggatcccagccgccgtatgagtcca
caggacgcattgaggcacgagttcattacgggggtgaaaatgccgtcccgagcaagaact
tatacactgacgacgcaatctcctgcgaagcgggcaactacgtcttctcacccttctgcc
ggccggccgctgccagaacctcctgtgaccagcctcaaatccggcacgctgatccgcaac
cgggatgcttcgggaacctctccagttaagctacccgcaggcaaacgccattcgactgtg
agtgggctaccgccgtcgacgcccgccaaacgagggaccagtattagcaccaccagtact
cctgggtcggcgctgcctcgcgttgcagcccggagtattagtggcaagccagacctcgcg
acggcggcggctgcgaccagcttgaggacgaaatga

DBGET integrated database retrieval system