KEGG   Aspergillus niger: ANI_1_634034Help
Entry
ANI_1_634034      CDS       T01030                                 

Gene name
An03g05070
Definition
agmatinase 1
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ang  Aspergillus niger
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ang00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 380 aa AA seqDB search
MYRLIAAAILLILPAYARDIVFPPVAAIHNNPSSHQYPLAHEDTIDIVTGSQFSGLTTFA
NLPYLNCFVDDESTLNNYDIAFLGAPFDTGVTARPGARFGPKGIRLGSRRLGGWSIYTGE
NAFASWAKLVDCGDAPLTWLDNTVALKQLDMAHKVVSSRRANTTHFSQIPRIITLGGDHT
TTLSALRSTYEKWGPVSVIHFDSHIDTWDPKVLGGGVSHYAGVNHGTFLHLAHEEGLIRN
TSIHVGIRAPVVRPKGDIRNDLRCGFEIITARDLDRLGVSGLVEQIKSRVGDSRVYISVD
IDVLDPAYAPATGTAEPGGFTTRELLTILDALRGMPVIGADVVEVAPIYDTAGETTTLAA
AEVAHSLLALMVAQPVRSDE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtctcattgcagctgctatcctgctcatcctgccagcctacgcgagggatatc
gtcttccctcctgtggctgccatccataataatccctcctcccaccaatatcctctcgct
catgaagacaccattgacatcgtcaccggtagccaattttcaggtctgactactttcgcc
aacctgccttacctcaattgcttcgtggacgatgaatcaactttaaacaactatgacatt
gccttcctcggcgctccctttgacacgggtgtcacggctcgccccggggctcgattcgga
cccaagggtattcgactcggctcccgtcgtctaggcggatggagcatctacacgggagaa
aacgcctttgccagctgggcaaagcttgttgactgcggcgacgccccattgacctggttg
gataataccgtggcattgaagcagcttgatatggcacacaaggtcgtctcgtctcgtcgt
gccaataccacgcatttcagccaaattccccgtatcatcaccctaggtggagatcacacc
acgactttgtctgctctgcggtcgacgtacgagaaatggggccctgtttcagtgattcac
tttgacagtcatattgatacatgggaccccaaagtgctaggtggaggagtctctcactac
gcaggcgtcaaccacggcacattcctccacctcgcccacgaagagggcctaatccgaaac
acctccatccacgtcggaatccgtgcccccgtagtccgaccaaaaggcgacatccgaaac
gacctccgctgcggctttgagatcatcaccgcccgtgacctcgaccgactcggcgtctcc
ggcctcgtagagcaaatcaaatcccgcgtcggggatagcagagtctatatctcggttgat
attgatgtgctggacccggcttatgcaccagcaaccggcactgcagagccaggtggattt
actacgcgtgaactcctgaccattcttgacgcgctgcgtgggatgcctgttatcggggcg
gacgtggtggaggtcgccccgatttatgacacagccggggagacgaccacgcttgcggcg
gcggaggtggcccattcgttgctggcgctgatggttgcgcagccggttaggagtgatgag
taa

DBGET integrated database retrieval system