KEGG   Aspergillus niger: ANI_1_672144Help
Entry
ANI_1_672144      CDS       T01030                                 

Gene name
An16g04720
Definition
phosphatidylinositol 3-kinase tor2
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ang  Aspergillus niger
Brite
Protein kinases [BR:ang01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   ANI_1_672144 (An16g04720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2390 aa AA seqDB search
MAQAGPITDVTHRLFAELKSKNEETRVRAAYELYDNVLAISRDWSPEKFLEFFNAVSQRI
AQLVVTGNDAHEKIGGLLALDRLIDFEGVDAAQKTTRFASYLRNALRSNDNAVLVYAAAA
LGRLAKPGGALTAELVESEIQSALEALQSERQESRRFAAVLVIRELAKGSPTLLYGFVPQ
IFELIWVALRDPKVLIREAAANAVSECFDIIAARDLQVRQLWFSRVYEEALLGLKSSNVD
WIHGSLLVLKELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVQTIPILASYAPLD
FTETYLHRFMIYLQAQLKRDKERNAAFIAIGKIANAVGVAIAQYLDGIIVYIREGLAMKA
RNRAAVQEAPMFECISMLSLAVGQALSKYMEALLDPIFACGLSESLTQALVDMAHYIPPI
KPIIQEKLLDMLSLILYGTPFRPLGCPESRLPPMPSFARDFAPQELHSDTEIALALHTLG
SFDFSGHILNEFVRDVAINYVENDNPEIRKASALTCCQLFVHDPIINQTSSHSIQVVSEV
IDKLLTVGVGDPDPDIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFPVREAAICII
GRLSSVNPAYVFPPLRKLLVNLLTSLGFASTARQKEESAQLISLFVSNATKLIRSYVDPM
VTTLLPKATDANPGVASTTLRAVGELANVGGSEMKTYLPQLMPIILDALQDLSSHSKREA
ALRTLGQLASNSGYVIDPYLEYSHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKY
QQISETAPVVHHINEVQTVSDVALIMQGLTPSSEEYYPTVVINTLMQNILRESSLAQYHS
AVIDAIVTIFKTLGLKCVPFLGQIIPGFISVIRGSPPSRLESYFNQMAILVNIVRQHIRA
FLPEIIEVVREFWEASYQVQATILSLVEAIAKSLEGEFKKYLAGLIPPMLDTLEKDTTMR
RQPSEKILHTFLIFGTSGEEYMHLIVPSIVRLFDRTQNPQSIRKSAIETLTKLSRQVNVS
DFASLMVHSLSRVVAGTDRVLRQAAMDCICALIFQLGQDFNHYIHLLNKVIKYNQINHVN
YHILVTKIQKGDPLPQDLNPEENYAALADDTNYAEIGQKKMVVNQQHLKNAWDASQKSTR
EDWQEWIRRFSVELLKESPSPALRACASLAGIYQPLARDLFNAAFVSCWTELYDQYQEEL
VRSIEKALTSPNIPPEILQVLLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKE
LEFEQDQNSGAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAA
YKRREKIDPDSFGVTMGKMRCLHALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWG
RGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFDEATMYIEKARNGLDTELSALLGES
YNRAYNVVVRVQMLAELEEIITYKQNIGDPEKQDSMRQTWNKRLLGCQQNVEVWQRMLKV
RALVTSPRENLDMWIKFANLCRKSNRMGLAERSLASLETVVSDSNGTRAIAPPEVTYARL
KFNWATGRQREALQMLKEFTSSLTEDLTRFNALMLSQADHNGINGVNGVNGVNGIADANH
ADAMGLRERIGDVAKFRRLLAKSYLRQGEWQTTLQRGDWRPEHVREVLNAYAAATKYNRD
SYKAWHSWALANFEVVTTIASQASRDGTTMAMVPGHIVTEHVIPALRGFLRSISLSSTSS
LQDTLRLLTLWFTHGGDQEVNSVVAEGFTAVNIDTWLAVTPQLIARINQPNIRVRSAVHR
LLAEVGKVHPQALVYPLTVAMKSNVARRSQSASNIMDSMRQHSAKLVEQADVVSHELIRV
AVLWHELWHEGLEEASRLYFGDHNVEGMFATLAPLHEMLDKGAETLREVSFAQAFGRDLA
EAKHYCMLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPKLKDCIDLDLA
VPGTYQSGRPIIRILSFDPILHVLQTKKRPRRMTLKGSDGNSYMYCVKGHEDIRQDERVM
QLFGLVNTLLDNDGESFKRHLSVQRFPAIPLSQSSGILGWVSNSDTLHALIKEYRESRRI
LLNIEHRIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSSSSEAWLERRTN
YTRSLGVMSMVGYILGLGDRHPSNLLLDRVTGKVVHIDFGDCFEVAMHREKYPERVPFRL
TRMLTFAMEVSNIEGSYRITCEAVMRVLRENKDSLMAVLEAFIHDPLINWRLGIRESPDR
MPFSAERRQSVVSNINIDHGVQPSNFSRHRRPSILEGGILDAQEGIPNEAREAQNARALQ
VLARVKEKLTGRDFKPSEELNVSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7173 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtcctatcacggacgttactcatcggcttttcgccgagttgaagtcg
aagaatgaggagacacgggtgcgagctgcttacgagctttacgacaacgttctcgctatc
tctcgagactggtcccccgagaagtttttggagttttttaacgcggttagccagcgcata
gcacaactggtagttactgggaatgacgcacacgagaagatcggtggcctgttggccctt
gatcgtctgatagactttgaaggagtggacgctgcgcagaagaccactcggttcgccagt
tacttgcgcaatgctcttcgcagcaacgacaatgcagtattggtctatgctgctgcggct
cttggccgtttggctaaaccaggcggagctctgactgcggagctagtggagagtgaaata
caatctgctctggaggcccttcagtcagaacgacaagaaagccgacggtttgctgccgtg
ctcgttatccgggagctcgcgaaaggctcacccacgcttctttatggcttcgttccccag
atcttcgagctaatttgggtcgctctgagggatcccaaggttctcatacgggaagctgcg
gctaatgctgtcagcgagtgctttgatataatcgctgctagagatttgcaggttcggcag
ctatggttctcaagggtatacgaggaagcgcttttaggtctcaaatcaagcaatgtggat
tggatacatggctcgctcctggttctcaaggagcttctcctaaagggcgccatgttcatg
aatgagcactaccgaaatgcctgcgagatagtcctccgtctcaaggaccatcgtgatccg
aaaatccgcactcaggttgttcagacaatcccgattctcgcctcctacgccccccttgac
ttcacagagacgtacctccacagattcatgatctatctccaggcccagcttaaaagagat
aaagaacggaacgccgcgttcatcgctataggaaagatcgcgaatgctgttggggtcgcc
atcgcacaatatctcgatggcatcatcgtttatatcagggaaggtctagcaatgaaagcg
aggaaccgagctgccgttcaagaagcgccaatgttcgagtgtatcagtatgctgtctttg
gctgtaggccaggcgctcagcaagtacatggaagcattactcgatcccattttcgcctgc
gggcttagcgaatccttaacccaagcgctggtcgacatggctcactatattccgccaata
aagcccataatccaagaaaaactactggatatgctaagcttgattctttatggcactcct
ttcaggcctttggggtgcccagagagcagattacctccaatgccctcatttgcacgggat
ttcgcccctcaagagctacactctgacacggagatcgcccttgcattgcacacactaggc
agttttgacttttcgggccatatccttaacgaatttgtgcgggacgtggcgatcaactat
gtcgagaatgacaaccctgagatccggaaagcttcagcactcacctgctgtcagctgttt
gttcatgatcctatcatcaaccagacaagcagtcattcgatccaagtcgtcagtgaggta
atcgacaagcttttgactgttggtgttggagatcccgaccctgacatccgacgtactgtc
ctgtggtccttggataggaaatttgatcggcacctagctagaccggagaacatcagatgt
ttattcttggctgtcaatgatgaagtgttccccgtcagagaggctgcgatctgtatcata
ggtcgcctttccagtgtcaaccctgcctacgtcttcccaccgctgcggaagctgcttgtc
aaccttttgacaagtctcggctttgctagcactgcacgccaaaaggaagagagtgcccag
ttgatcagcctgtttgtttcgaatgcgacgaaattgatccggtcctatgttgatcctatg
gtgactacactgctacccaaggcaaccgacgccaatcctggtgtcgcttccactacattg
agggccgttggtgaacttgcaaatgtgggtggcagtgaaatgaaaacatacctgccgcag
cttatgccgattatcctggatgcgctacaggatctctcttctcattccaagcgcgaggcg
gccttgaggacactgggccagctggccagcaactccggttacgttattgatccatacctc
gaatattctcatctactcgcagtccttatcaacatcatcaagaccgagcaaaccgggtct
ctgcgtaaggagacaatcaaattactgggtattcttggagccttggacccctacaaatac
caacagatcagcgagaccgcgccggtagttcatcacatcaatgaagtgcaaactgtatct
gatgtcgcgcttatcatgcaaggcctcacgccgtccagcgaggagtactaccctacagtt
gttattaacacgctaatgcaaaacatcttgcgtgaatcgtctcttgcgcagtatcactct
gcagtcattgatgccattgtgacgatattcaagacccttggtctgaaatgcgtaccattc
cttggacagataataccaggtttcatatcggtcatcagaggatcacccccgagccgcctt
gaatcgtacttcaatcagatggcgattctggtcaatatcgtgcggcaacacatacgagcc
tttttgcccgagatcattgaagtcgtccgtgaattctgggaagcttcctaccaagttcag
gctacaatactctcgctcgtggaagcgatcgccaagtcattggaaggtgaattcaagaag
taccttgcaggcctgatccctccgatgctcgacacgcttgagaaggacaccacgatgcgt
cgtcaaccttcggagaagatactccacacatttttgatattcggtacaagcggagaggag
tatatgcacctgattgttccctccatcgtgcgactttttgacaggactcaaaacccccag
agtatccgaaagtccgctattgagaccctcaccaagctttcacggcaggtgaacgtctcg
gacttcgcatcattgatggtccattctctgtcccgggttgttgcaggcaccgatcgcgtg
ctgcgacaagctgctatggactgtatctgcgcgctcatctttcagctaggccaagacttc
aaccactacatccacctgctgaataaggtcataaagtataaccagatcaatcatgtcaac
taccacatcttggtgacgaagatacaaaagggggatccgctcccacaagacctcaatccc
gaggaaaactacgcggcactggcggatgacaccaattatgccgagattggacaaaagaag
atggttgtcaaccagcagcacttgaagaatgcttgggacgcctcacagaagtctactcgt
gaagactggcaagagtggattcgacgatttagcgttgaattgctgaaagagtcaccttct
cccgctcttcgagcatgcgcgagtttggctggtatatatcagcccttagcgagggatctc
ttcaacgcggcgtttgtttcctgctggaccgagttgtatgaccaataccaagaagagctc
gtccggtcgatcgagaaggccctcacctcacctaatatacctcccgaaatcctgcaggtt
cttcttaacctagcggaattcatggagcatgacgacaaggcccttcccattgatatccgc
actctaggcaagtacgctgctaaatgtcacgcgttcgcgaaggccttgcattacaaggaa
cttgagtttgagcaagaccagaactcaggggcagtggaggctttgatcaccatcaacaat
cagcttcagcaatctgatgctgcaattggtatcttgcgaaaagcgcaggcttaccgggat
gtggagctcaaagagacatggtttgagaagcttcaacgttgggaggaggctcttgctgcg
tacaaacgacgtgagaagatagacccagattccttcggagtcacgatgggtaaaatgcgc
tgtctccatgctctcggtgagtggaaggtgctctccgacctcgcccaggagaagtggaac
caggcatccctcgaacatcgcagagccattgcacctctagctgcagcggctgcgtggggt
cgcggccagtgggaattgatggattcctatcttggtgtaatgaaggagcagtcgccagat
cggtccttcttcggcgccatccttgccattcaccggaatcagtttgacgaagcaaccatg
tatattgaaaaggctcgcaatggtttggacacagagctttcagcactgctgggagagtcg
tacaaccgtgcctacaatgttgttgtgcgtgttcaaatgctcgctgagctcgaggagatc
attacgtacaaacagaacattggcgatcccgagaaacaggattcgatgcgtcaaacatgg
aacaagcgactactcggctgtcaacaaaatgtagaggtatggcagcgcatgctcaaggtt
agggcgcttgtcacctctcctcgtgagaacctcgacatgtggattaaattcgccaatctc
tgtcgcaaatccaaccgtatgggactcgccgagcggtcgctcgcatcactggagaccgtg
gtttccgacagcaacggcacgagggcaattgctcccccagaagttacctatgcccgattg
aagttcaactgggccaccggacgtcaacgcgaggcccttcaaatgttgaaggagttcact
tcaagcctgacagaagaccttacacggttcaatgctctcatgttatcgcaggcggatcat
aatggaataaatggagtcaatggcgtgaacggagtcaacggaatagcggatgccaaccat
gcggatgcaatggggctgcgagaacgcatcggcgatgttgctaagttcagaaggctacta
gcaaagagctatctccgccaaggtgaatggcagacaacgctgcagcgaggtgattggaga
ccggaacacgttcgtgaagtgctcaatgcgtatgccgctgcgaccaaatacaaccgtgat
tcatacaaagcatggcattcgtgggcattggcgaactttgaagtcgttacgacgattgct
agccaagccagcagagatggcacgacaatggccatggtccccggacacattgtcacggag
catgtaatacctgcacttcgcggcttcctcaggtcaatttcactgtcgtcaacctcatcc
ctgcaggatacattgcggttgctgacactctggttcacccacggtggtgatcaggaagtg
aacagtgttgtagcagaaggctttacggcagtgaacattgatacctggcttgctgtcact
ccacagcttatagctcggatcaatcaacctaatatccgagtgcggagtgctgttcatcgg
ctgctggctgaagttggcaaagtacatccccaggctttggtgtacccattgaccgttgca
atgaagtctaatgttgctcgacgatcgcaatccgccagcaacattatggacagcatgcga
cagcacagtgcgaaactcgtggagcaagctgatgttgtaagtcatgagctgattcgagtc
gcggtcttgtggcacgagctctggcacgaaggcctagaagaagcctcccgactctacttt
ggcgatcacaatgtggaaggcatgtttgcaactctagcgcccttgcatgagatgctcgat
aagggtgccgagacgttgcgcgaggtgtcatttgctcaggcctttggtcgcgatcttgca
gaggcgaagcactattgtatgctctaccgggagactgaagagattggtgatttgaaccaa
gcatgggatctttattacacagtattccgcaagatcagccggcagctgccacagctctcc
acgctcgatttgaaatacgtttcacccaagctcaaggattgtattgaccttgaccttgcg
gtcccaggtacataccaaagtggcaggcccatcattcgcatcctcagcttcgatcccata
ttacacgtactacagaccaagaagagaccacggagaatgacattgaagggcagtgacgga
aactcgtacatgtactgtgtgaagggacacgaagacatccggcaggatgaacgtgtcatg
cagctcttcggcctggtcaacacactacttgataacgatggagagagtttcaaacggcat
ctgtctgtgcaacggttccctgcaatcccgctatcacagagctctggtatccttggatgg
gtttccaacagtgacacattgcatgccttgatcaaggaataccgagaaagccgacgtatc
ttgctgaacattgaacaccgcattatgctccaaatggcgcccgactacgataatcttact
cttatgcagaaggtggaggtgttcggctatgccatggacaataccactggaaaggacctc
tatcgcgttctatggcttaagagtagtagctcggaggcctggctggagcgccgcacgaac
tacacgcgttcccttggtgtcatgtccatggttggttacatacttggtcttggcgatcgt
cacccgtccaatttgcttctggatcgggttaccggaaaagtggtccatatcgacttcggt
gactgcttcgaggtggcgatgcaccgtgagaagtatcctgagagggtacctttccggttg
actcgtatgttgacatttgccatggaagtcagcaatatcgaaggaagttaccggattact
tgcgaggctgtcatgcgtgtcttgagagagaacaaggattccctcatggctgttttggaa
gcgttcattcacgatccactgatcaactggcgtttggggatccgcgagtccccagatcga
atgccattttctgccgagcgtcgtcagtcggtcgtctctaacattaatatcgatcatggg
gtacagcccagcaacttctctcgtcaccgccggccttccattcttgagggtggtatcttg
gatgcacaggagggcattcccaacgaagctagagaggcacagaacgcgcgagcgctccag
gtgcttgcccgtgtcaaggagaagctgacaggaagagatttcaagccgagtgaggaactc
aacgtcagcgaccaggtggacaagcttcttgcgcaagccaccagtgtcgagaacatctgt
cagcattggattggatggtgcagtttctggtga

DBGET integrated database retrieval system